KEGG   Gamma proteobacterium HdN1: HDN1F_12160
Entry
HDN1F_12160       CDS       T01300                                 

Definition
(GenBank) Protein of unknown function (DUF877)
  KO
K11900  type VI secretion system protein ImpC
Organism
gpb  Gamma proteobacterium HdN1
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gpb02044]
    HDN1F_12160
Secretion system [BR:gpb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HDN1F_12160
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CBL44799
UniProt: E1VJ07
Position
complement(1505977..1507449)
AA seq 490 aa
MVSFSGQVSETEVIDSPMLDEILEFTRLPRQDDSYLVARNGVKAMLEEVFRKSEDDTVRI
DKLFIDELINELDQVISRQMDAILHHPEFQRIEAPWRSMKFLVDRTDFSENIKLEYINAT
KDDLLADFEDAAGVVDSGLFRQLYTEEFGQFGGEPVGAIIGNFEFSPGSEDIKLLEYLAS
LSAMTHAPFIAAAGPEFFGLGDYSGLPQIKQLEAIFDGPQYMKWRGLRESDDARNIGLAM
PRFMLRGTYGDQIGVRSFNYRESISGKTDFLWGNAAFSYATRLTESFASYRWCPNIIGPQ
SGGATVDMPVHISEENGRTDVNGPVEITISDRKEYELSELGFIPFTMRKDSDSAVFFSSN
SIQKPKLFGNDDEGKQAELNYRLGTQMPYLFIVNRLAHYIKVLQRENLGSWKSRGDIEME
LNKWIRQYVADQENPSASTRSQRPLRKANLKVSEVDGEAGWYRVALEITPHFKFMGANFT
LSLASMIERA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggtaagtttttccggtcaggtttctgaaaccgaagtaattgattcgccaatgctcgac
gaaattctcgaattcacccgtcttcctcggcaagatgacagctatctggttgcacgtaac
ggcgttaaagcgatgttggaagaagtcttccgcaaatcggaagacgacactgttcgtatc
gacaaactgtttattgatgagctcatcaacgaactcgaccaagtcattagccgacaaatg
gatgccatactgcatcatccggaatttcagcgtattgaagccccatggcgcagcatgaaa
ttccttgttgatcgcacggattttagcgagaacattaaactcgaatacatcaacgcaacc
aaagacgatttacttgcagacttcgaagacgccgccggcgttgtagattcgggcctgttt
cgccaactctacaccgaggaattcggccagtttggcggtgaaccagttggcgccattatc
ggcaacttcgaattttctcccggttctgaagacattaagctactggaatacttggcaagc
ctgagcgcaatgacacatgcgccatttatcgcagccgccggccctgaattctttggccta
ggtgactacagcggcctaccacaaatcaagcagcttgaagccatttttgacggcccacag
tacatgaaatggcgcggcctgcgcgaatcggacgatgcccgcaatatcggcctcgcaatg
ccgcgctttatgctacgtggcacctacggagatcagatcggcgtacgctccttcaattac
cgtgagagcatttccggaaaaaccgattttctttggggaaacgcagcgtttagctacgct
actcgactgacggaaagctttgccagctatcgctggtgtccaaacatcatcggaccacaa
tctggcggcgcaaccgtggatatgccagtccatatttcggaagaaaatggccgcaccgat
gtcaatggcccagtggaaatcaccatttctgaccgcaaggaatacgagttgtcagaactt
ggatttattccctttaccatgcgcaaagattcggatagcgcggttttcttctcatccaac
tccatccaaaaaccaaaactattcggcaacgacgacgaaggcaagcaggcggagctgaac
tatcgcctcggcacgcaaatgccctacctgttcatcgtcaaccggctcgcacactacatc
aaggtattgcagcgcgagaaccttggcagttggaaaagccgtggcgacatcgaaatggaa
ttgaataagtggattcgccagtacgttgccgatcaggaaaacccctctgcatccacacgc
agccagcgcccattacgcaaagcaaacctcaaggtcagcgaagtggacggcgaagccggc
tggtaccgggttgcgcttgaaatcacgccacatttcaaattcatgggcgccaattttacc
ctctctctggcaagcatgatcgagcgggcctaa

DBGET integrated database retrieval system