KEGG   Gamma proteobacterium HdN1: HDN1F_12170
Entry
HDN1F_12170       CDS       T01300                                 

Definition
(GenBank) Protein of unknown function (DUF770)
  KO
K11901  type VI secretion system protein ImpB
Organism
gpb  Gamma proteobacterium HdN1
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gpb02044]
    HDN1F_12170
Secretion system [BR:gpb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HDN1F_12170
SSDB
Motif
Pfam: T6SS_VipA DUF3113
Other DBs
NCBI-ProteinID: CBL44800
UniProt: E1VJ08
Position
complement(1507524..1508012)
AA seq 162 aa
MAKKNSGSVAPKERINISYKPATGNARETVELPFKLVVLGDFTNKQDDRTVEDRAPVEVN
KHNFDDVMKGANLSLQFSVDNHLSQQENSEISVDIPVQSLKDLEPDSLMKLIPELRRVHE
LRESLMALKGPLGNSPQMRRTIMAMIQDKEQRGRLMQEIGLR
NT seq 489 nt   +upstreamnt  +downstreamnt
atggcaaaaaagaacagcggttcagttgcaccgaaagagcgtatcaatatttcctacaaa
ccggcgacgggaaacgctagagaaaccgtcgaactcccttttaaattagtcgttcttggt
gacttcaccaacaaacaggacgaccgtaccgtcgaagaccgcgcgcccgtagaagtcaac
aagcacaacttcgacgacgtgatgaaaggggcgaatctctccctgcagttttcggtagac
aatcacctcagccaacaagaaaactctgaaatttccgtagacattccagtgcagtcgctc
aaggatcttgaacccgacagcctgatgaaattgatcccagagcttcgccgagttcacgag
ctaagagagtcgctcatggcgctcaaagggccgcttgggaacagtccacaaatgcgtaga
accatcatggcaatgatacaagacaaagagcagcgcggtcgattgatgcaagaaatcggg
cttcgctaa

DBGET integrated database retrieval system