KEGG   Gamma proteobacterium HdN1: HDN1F_18030
Entry
HDN1F_18030       CDS       T01300                                 

Definition
(GenBank) Hypothetical protein
Organism
gpb  Gamma proteobacterium HdN1
SSDB
Motif
Pfam: TraU CRCB
Other DBs
NCBI-ProteinID: CBL45386
UniProt: E1VKP4
Position
complement(2255726..2257051)
AA seq 441 aa
MLSGSQAMVAAPVSQTVPVSGANIVDLIKVGLTGISGGCLNYCITGICVHYNGLKVIISP
RIAHNTSEFTVSSFRAQGQQPWIEWKRVFGNIQASLANGIFGTLLGTGQIGGYGTYTEEH
KENDRQLPFKEVDINGHPLALLPMLLGSGGMTAGGATQPPTEADFTEAQTAAGSMVDASD
FAAMFMNSEILDVFSYMNTMNQIGTMASEMSEVMDYLSSMQDLASGMGGSGSYDLLCEST
VTPFIPFYLSAIDTLTWRLPWPDVLTHSVDLAYGMTPFLPNRKVIGTPDAMPTLTNGVWA
GLYPRIGFVNQEHDGKVGAVASQRALDLVLAEDGNDHFGHVTLFNPGFANQRDWHIIPYE
FHASGVKGGVWQQVHPIPKAECRPSLYRDRELSDTAEDHSAPVVLGGDQNYIWAFWRRYE
CCMNRKGVFIGAIPTPDICLF
NT seq 1326 nt   +upstreamnt  +downstreamnt
gtgctgtcaggcagtcaggccatggtcgccgcccccgtttcacaaacggtgcccgtcagt
ggcgcaaatatcgtcgatctgattaaagtcgggctcaccggaatctccggtgggtgcctg
aactattgcatcaccggtatttgcgtccactacaacggcctcaaggtcatcatcagcccg
cgaattgcgcataacacctcagaatttaccgtgtcctcctttcgggcgcagggccagcag
ccgtggatcgaatggaagcgtgtgtttggcaatatacaggccagtttagccaacggtatt
ttcggtacgctgctcggcacagggcagattggtggatatggcacctacaccgaagagcac
aaagaaaacgaccgccaattgccattcaaagaagtcgatattaacggccatccgctggcg
ctgctgcccatgctattgggttcaggtgggatgaccgcaggtggagccacccaaccgcct
acagaggctgactttaccgaagcacaaactgcggcaggcagcatggtagatgcctcagat
tttgccgcaatgttcatgaactccgaaatcctcgacgtattttcgtacatgaatacgatg
aaccaaatcggcaccatggcgagtgaaatgagcgaggtgatggactatctgtcgtccatg
caggatctggcttcgggcatgggggggagtggcagttacgacttgctctgcgagagtaca
gtaacgccgttcattccgttctatttaagcgccatcgacacgctgacgtggcgcctaccg
tggccggatgtactgactcattcggtggacttggcgtatggtatgacgcctttcttgccg
aaccgtaaagtgatcggcacccctgatgctatgccgacactcaccaacggcgtgtgggca
gggctttatccgcgcattggatttgttaaccaagaacacgatggcaaagtgggcgcggtg
gcgtcccagcgtgcccttgatcttgtcttggccgaggacggaaacgatcattttggccac
gtcacactttttaatcccggctttgccaaccagcgcgactggcacatcatcccctacgaa
tttcatgccagcggcgtgaaaggcggagtgtggcagcaggtgcatcccatccccaaagcg
gagtgccgcccctctctgtaccgtgaccgagagctcagtgataccgcagaagatcacagc
gcaccggtcgtgctgggtggcgaccaaaactacatctgggcgttttggcggcggtatgag
tgctgcatgaatcgcaaaggcgtatttattggtgcaatcccaacgcccgatatttgcctg
ttctag

DBGET integrated database retrieval system