KEGG   Gamma proteobacterium HdN1: HDN1F_18170
Entry
HDN1F_18170       CDS       T01300                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
gpb  Gamma proteobacterium HdN1
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C DUF87 CobU FtsK_SpoIIIE AAA_10
Other DBs
NCBI-ProteinID: CBL45400
UniProt: E1VKQ8
Position
complement(2267540..2269669)
AA seq 709 aa
MVSSRIEGLLRPPIEFASAIAYSAVAGLMMAAPYELMMTPTVAAATGSGLLALAALRFRS
AWRVFKYQKGLKKLPHYSLAFDQLRVSKERLFIGKGFEWEPKHTQRMHECEQPGAERYIK
PGKFYQLARWIDGRAEYSNVMRSVSRLTRSSSRWNPVAPIADVGGYPAIHGVGLLERERD
VYMKLSERVGHLLVLGTTRVGKTRFAEMLIAQDIARGDVVIVFDPKGDAELMKRVYREAK
RAGRLEQLYIFHLGYPEVSARYNPVGQFTRITEVASRIAGQMPGDGASQAFREFVWRYVN
VIAACRNALGVRPGIEQIKYDAENLEPLVVEYLEFLLERECRSGPLSNWKKTIDDWAAAF
DDAQEKEFRKPRHMGDRSSRAMALCKFYKDHKNDHRLHDTCAESLITTFFYDTAKFNMLI
ASLMPLMEKLCTGKCAELISPDYLDGDRHRPIFTWAEVIRTGGIVYVGLDALSDPEVAAA
VGNSMFADLTSGSGLLYKHGADHGLPFSVGGRRVYIHADEFNELVGKEFIPLLNKAGGAG
YGVTAYTQTWSDVVARLGNEAQAGQVAGNLNSLVMLRTIEYATIEMLTKRLRQVDVAHAM
DVSGASDVSDPDANTSFSSRTEQRVTSQRVERVHPNDVLRLPKGQAFAMTDGGTLSKIRL
PLPDPADLADLPRTLQDMSDDMAKHYRSDKNWYHFQSCFDVPGAFNGLK
NT seq 2130 nt   +upstreamnt  +downstreamnt
gtggtgagctcacgaattgaagggttgttgaggccgcccattgaatttgcttcagcgatt
gcatacagcgctgttgcgggtttaatgatggctgcgccttatgaattgatgatgacacct
acggtggctgcggcaacaggaagtggcttgctcgcgctcgcggcgttacgatttcggtct
gcgtggcgagtatttaaataccaaaagggcctaaaaaagctgccgcactattcgctcgca
ttcgatcaattgcgcgtcagcaaggagcggttgtttatcggcaagggatttgagtgggaa
cccaaacacacgcagcgaatgcacgaatgcgagcagcccggtgccgagcgctatattaaa
cccggaaaattctaccaactggcgcgctggattgatggacgtgcggagtacagtaacgtc
atgaggtcggtgagccgtctgacgcggagctcgtcgcgctggaaccccgtcgcgccgatt
gcggatgtaggaggctatcccgccattcacggcgtgggcctgctagaacgcgaacgtgat
gtgtacatgaaactgtccgagcgcgtaggtcatttgcttgtgcttggaacgacccgtgtc
ggcaaaacccgctttgctgaaatgctgatcgcgcaggatattgcacggggcgacgtagtc
atcgtctttgatccgaagggcgacgccgagctgatgaaacgggtgtaccgagaagcgaag
cgtgccggtagactggagcagctttatatctttcatctgggctatccggaagtttctgca
cgttacaatccggtaggccagtttactaggatcacggaggtggcctcacgcattgcaggc
cagatgccgggggatggtgcctcacaagccttccgtgagtttgtctggcgctacgtgaac
gtcattgcagcgtgccgtaacgcgctcggcgtgcggccgggtatcgagcagattaaatac
gacgccgaaaacctcgaaccgctcgtcgttgagtatttggaatttttgcttgaacgtgag
tgccggtcggggccgttgtcgaattggaaaaaaaccattgacgattgggcggcggcattc
gacgacgctcaagaaaaggagtttcgcaaaccgcgacacatgggcgaccgcagcagtcgt
gcaatggcgctgtgcaagttttacaaagaccacaaaaatgatcatcgtttgcacgatacc
tgtgcggagtcgttgatcacgacgtttttctacgatacggcaaaattcaacatgctcatt
gcatcgctgatgccgctcatggaaaagttatgcacgggcaaatgcgcggagctgattagc
cctgattatttagatggcgaccgacaccgccctatatttacatgggcggaagtgatccgc
actggcggcatcgtctacgtggggctggacgccttgtctgatccggaggtggcggcggcg
gtaggaaattcaatgttcgcggatttaacctcgggttctggtctgctgtacaaacacggt
gccgatcacggtttgccgttttccgtcggcgggcggcgcgtctatatccatgcggatgaa
tttaacgagctggtgggcaaggagtttatcccgttgttgaacaaggcggggggtgcgggt
tatggcgtgacggcgtacacgcagacatggtcagatgtggttgcccgcttgggtaacgaa
gctcaagcagggcaagtggcgggaaacttaaactcgctggtgatgttgcgcacgatcgaa
tacgcgacgatcgaaatgctgacaaagcggctgcggcaggtggacgtggcccatgcgatg
gatgtatcgggcgcctctgatgtgagcgacccagatgcgaatacgtcgttctcctcacga
acagagcagcgtgtgacgtcgcagcgcgtggagcgtgtccatccaaacgacgtacttcgg
ttgcccaaaggccaagcgtttgcgatgacagatggcggcacgctttcaaaaatccggctc
ccattacctgacccggcagatttggccgatttacctcgtaccttgcaagatatgtcggac
gatatggcgaagcattaccgctctgacaaaaattggtatcactttcaatcgtgctttgac
gtaccgggagcgttcaatggcctcaaatga

DBGET integrated database retrieval system