KEGG   Gamma proteobacterium HdN1: HDN1F_18190
Entry
HDN1F_18190       CDS       T01300                                 

Definition
(GenBank) Hypothetical protein
Organism
gpb  Gamma proteobacterium HdN1
SSDB
Motif
Pfam: SLT Glucosaminidase SLT_2 SLT_3
Other DBs
NCBI-ProteinID: CBL45402
UniProt: E1VKR0
Position
complement(2270261..2270800)
AA seq 179 aa
MSTASGLRRFIGALLLTVSAYADAGVPAAYQAVASQYGVPPEVLYAIALTESRHTVSGLV
RPWPWTANVEGKPYFFASRTEMSAFLTGLLRRGNRKFDVGLMQISWRHHGHRFRSVDEAI
DPLTNLQAGAAYLRYLIKRRGVENAIGMYHTGEAGPMDRQRHYRKLVYASLDRIRSGRI
NT seq 540 nt   +upstreamnt  +downstreamnt
gtgagcactgcaagcggattgagacgctttatcggggctctattgctcaccgtcagtgcc
tatgcagatgcgggtgtgcccgcagcgtatcaggcagtcgcgagccagtacggtgtgccg
ccggaggtgctgtatgccattgcactgaccgagtctcgacataccgtaagcggcctcgtg
cggccttggccgtggacggccaatgtggagggaaaaccgtatttttttgcgtcacgtacg
gagatgtccgcctttctcactgggttgttgcggcgcggtaatcgaaaatttgatgtgggc
ttgatgcaaatttcgtggcgtcatcacggccatcggtttcgcagtgtggatgaggccatt
gacccgctgaccaatctgcaagctggggccgcatatctacgttacctgatcaaacggcga
ggtgttgaaaatgcgatcggtatgtatcacacgggtgaagcgggcccaatggatcgccaa
cgccattaccggaaacttgtgtatgcctcactcgatcgcatccgttctgggagaatttag

DBGET integrated database retrieval system