KEGG   Gamma proteobacterium HdN1: HDN1F_20790Help
Entry
HDN1F_20790       CDS       T01300                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
gpb  Gamma proteobacterium HdN1
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HDN1F_20790 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CBL45662
UniProt: E1VLH0
Position
complement(2584420..2584797)
Genome map
AA seq 125 aa AA seqDB search
MSDDHDIHIEVRSEYLAQQSAPDHSRYAFAYHVRIENRGKLGATLLSRHWLITDGNHETQ
EVRGDGVIGEQPLIPAGQHYEYSSGAMLTTPVGSMTGSYQMRDEAGEKFDARIPIFTLAQ
PRLLN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaccacgacatccatattgaagttcgcagcgagtacctcgcccagcaatcc
gcccccgatcacagccgctacgcattcgcttaccacgtccgcatcgaaaaccgtggcaaa
ctcggcgccaccctactcagccgccactggctgattaccgacggtaatcacgaaacccaa
gaggtgcgcggcgacggcgtgattggtgagcaaccgctgattcccgcaggtcaacattat
gaatactccagcggtgctatgcttaccacacccgttggcagcatgaccggcagctaccaa
atgcgcgacgaggcaggcgaaaaattcgacgcccgcattccaatttttacccttgcacaa
cctcgtctcctgaactga

DBGET integrated database retrieval system