KEGG   Gamma proteobacterium HdN1: HDN1F_28260Help
Entry
HDN1F_28260       CDS       T01300                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00900  Terpenoid backbone biosynthesis
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HDN1F_28260 (dxr)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HDN1F_28260 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NmrA Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CBL46409
UniProt: E1VNL7
Position
3476654..3477862
Genome map
AA seq 402 aa AA seqDB search
MKGSRGITVLGSTGSIGVSTLDVVARHPERFHVVALTAHSNVERVVEQAIQFQPRYVVMV
DAKRAQQVRERLAARALGVNMAKNTEVLSGVDALCEVAALPEVDVVMAAIVGAAGLLPTL
SAVRAGKRILLANKESLVMGGEFFMRAVQESGAELLPVDSEHNAIFQCMPAKVQTGLENA
GVARILLTGSGGPFRNTPLAQLPAVTPAQACAHPNWSMGRKISVDSATMMNKGLEFIEAC
LLFNARPDQVEVVVHPQSVIHSMVEYLDGSVLAQMGNPDMRTPIAHALGWPERIRSGVPL
LDLIKVAQLHFEAPDEARFPCLRQAKSAALVGGWAPIALNAANEVAVDAFLNEKIRFTDI
ANLIDGVLQGMTASTIEGIECILAVDQEARRSACQALERLRR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaagtaggggcattacggtgctgggtagcaccggttccatcggagtcagcacg
ctggatgttgtagcacggcaccctgagcgattccatgtggttgctttaaccgcgcattcc
aacgtagaaagggtggttgaacaagccatacaattccagcctcgctatgttgtgatggtg
gatgcaaagcgcgcgcaacaggtacgtgagcgccttgctgcgcgcgcgcttggcgtgaat
atggccaagaacacggaagtcctctccggcgtcgatgcgctgtgtgaggttgcagcgctt
cctgaagtggatgttgtgatggcggcaatcgttggggcggctggacttttgcctacgctt
agcgccgttcgtgccggtaaacgaattttgctggcaaacaaagaatcgctcgtcatgggc
ggcgaattctttatgcgcgccgtgcaagagagtggcgcggagctgctacccgtcgatagc
gaacacaacgcgattttccagtgcatgcccgcaaaggttcagactgggcttgagaatgca
ggtgttgcccgcatcttacttacaggctcgggtggcccgttccgaaatacgccccttgca
cagctcccagcagtgacgccagcgcaggcgtgcgcgcatcccaattggtcaatggggcga
aaaatttcggttgattctgccaccatgatgaataaaggcttggaatttattgaagcctgc
ctattgtttaacgcgcggccagaccaagtcgaggtagtggtgcatcctcagagcgtgata
cattcaatggtggaatacttggacggttccgtgctggctcaaatgggcaatccagacatg
cgaacccccatcgcacatgcgctgggctggccggagcggattcgatccggcgtgccgctg
ttggatctgatcaaagtagcgcaactgcattttgaggcgcctgacgaggcgcggtttccg
tgtttaaggcaagcgaaatcagctgcattggtcggcggttgggcgccgatcgcgctcaat
gcagcgaacgaagtggcggttgatgcattcttgaatgaaaagattcgttttacagacatc
gccaatctgattgacggcgtgctgcaaggcatgacggcgagtacaatagaaggcattgag
tgcattctggcggtcgatcaagaagcacggcgctcggcgtgccaagctcttgaacgcctc
aggcggtaa

DBGET integrated database retrieval system