KEGG   Gamma proteobacterium HdN1: HDN1F_34210Help
Entry
HDN1F_34210       CDS       T01300                                 

Definition
(GenBank) 3-oxoacid CoA-transferase subunit B family enzyme
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00072  Synthesis and degradation of ketone bodies
gpb00280  Valine, leucine and isoleucine degradation
gpb00650  Butanoate metabolism
gpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HDN1F_34210
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HDN1F_34210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HDN1F_34210
Enzymes [BR:gpb01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     HDN1F_34210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: CBL47004
UniProt: E1VQB2
Position
complement(4156339..4156995)
Genome map
AA seq 218 aa AA seqDB search
MALTREQMAQRVARELQDGYYVNLGIGIPTLVANYIPKGMTVMLQSENGLLGMGPFPTEA
ELDADLINAGKQTVTAITGASYFSSADSFAMIRGGHVDFTVLGAFEVDIEGNIASYMIPG
KMVKGMGGAMDLVAGAANIIVTMTHASKHGESKLLTRCSLPLTGAGCIKKVVTDLAYVEI
REGKFWLKERAPGVSVDEIVRLTEGKMVIPDVVPEMEF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcacttacacgtgaacaaatggcacaacgggtggcgcgcgagctgcaagacggctac
tacgtcaaccttggcattggcattccaacgctcgttgccaactacattcccaaaggcatg
accgtcatgctgcaatcggaaaacggcttgctcggcatggggcctttccctaccgaagcc
gagctggatgctgacctgatcaacgccggaaaacaaaccgtaaccgcgatcaccggcgca
tcgtatttctcctccgctgattccttcgcaatgatacgcggcggccacgtagactttacg
gtgctaggcgcgttcgaggtggacattgaaggcaatattgcctcctacatgatccccggt
aaaatggtcaaaggcatgggcggtgcaatggacttggtggccggtgcggccaatatcatc
gtaaccatgacacatgcatccaagcacggggaatccaaactgctgacacgctgcagcttg
cccttaactggcgctggatgcatcaaaaaagtggtgacggatctcgcctatgtggagatc
cgcgaaggcaaattctggctaaaagagcgggcaccaggcgtaagcgtggatgaaatcgtg
cgtttaacggaaggcaagatggtaatccctgacgtggttccggaaatggaattttaa

DBGET integrated database retrieval system