KEGG   Gamma proteobacterium HdN1: HDN1F_35080
Entry
HDN1F_35080       CDS       T01300                                 

Definition
(GenBank) probable phage associated protein
Organism
gpb  Gamma proteobacterium HdN1
SSDB
Motif
Pfam: DUF2895 NnrU
Other DBs
NCBI-ProteinID: CBL47091
UniProt: E1VKQ2
Position
4247882..4248526
AA seq 214 aa
MAAYHDLIDEKDRIIRYISRVSIGLLIGLVLAIFGWMRAQHEITVYQPPDIRLHTVSSAG
YIPEETVYAFVPLIMQQLYLWDNGGDQDYENNRYRVRQFLTDKYQRTILDEIETGKLRGT
LKGLQRRLQVLPSSVYSDSSVEVVGNYWRVWIDVKITDSIKNMKVNDGVHRLAVRVVRYD
INRDANPWQLAIDGIEQDIPLVSAKTVPLTPEKN
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcagcgtatcacgatttaatcgacgaaaaagaccggatcattcgctacatcagccgc
gtgtcgatcgggctgttaattgggctggtgttggccatttttggctggatgcgtgcacaa
cacgagatcaccgtgtatcagccccctgacattcgactgcacacggtatccagtgcgggg
tatatcccagaagaaaccgtgtacgccttcgtcccgctgatcatgcagcagctgtatttg
tgggacaacgggggcgatcaagattacgaaaacaaccgctaccgagtgcgccagtttcta
accgacaaataccaacggacgattctggacgaaatcgaaaccggaaagctgcgtggaact
ctcaaagggttgcagcgcagattgcaggttctgccgtccagcgtgtactcggattcctct
gtagaggttgtgggaaactactggcgcgtctggatcgacgtcaaaatcaccgactcgatt
aaaaacatgaaggtgaatgatggcgtgcaccgcttggccgtgcgagtggtgcgttatgac
attaaccgcgatgcgaatccgtggcagttggcgatcgacgggattgagcaagacataccg
ctggtatcggcaaaaacggtaccgctgacgcctgaaaaaaattga

DBGET integrated database retrieval system