KEGG   Gemmatimonas phototrophica: GEMMAAP_11045Help
Entry
GEMMAAP_11045     CDS       T04580                                 

Definition
(GenBank) magnesium transporter
  KO
K06195  ApaG protein
Organism
gph  Gemmatimonas phototrophica
Brite
KEGG Orthology (KO) [BR:gph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GEMMAAP_11045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMW05204
UniProt: A0A143BL84
Position
complement(2615171..2615581)
Genome map
AA seq 136 aa AA seqDB search
MSDRLSFYYRMTSGIRITVRPSYLRERSNPLLGQFVFAYHIRIENVGDQAAQLRTRRWLI
HDEAVGDTVVEGEGVVGEQPHLLPGQIHEYRSFCVLKAPNGWMEGTYRFVRDDGSSFLAV
IPRFTLAAEPRTDTVL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgcctttcgttctattaccgcatgacgtcggggatccgcatcaccgtgcgc
ccgtcgtatctgcgcgaacggtccaatccgctgctggggcagttcgtctttgcctaccac
atccgcatcgagaatgtgggtgaccaggcggcgcagttgcggacacgccgctggctcatt
cacgatgaagcggtgggcgacaccgtcgtggaaggcgaaggcgtggtgggagaacagccg
cacctgctccccggacagattcacgaataccgctcattctgcgtactgaaggcgcccaac
ggctggatggagggcacctatcgcttcgtgcgcgatgatggttcgagttttctggccgtt
atcccccggttcacgctcgcggccgagccgcggacagatacggtactctag

DBGET integrated database retrieval system