KEGG   Gemmatimonas phototrophica: GEMMAAP_11920Help
Entry
GEMMAAP_11920     CDS       T04580                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gph  Gemmatimonas phototrophica
Brite
KEGG Orthology (KO) [BR:gph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    GEMMAAP_11920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMW05317
UniProt: A0A143BJR7
Position
complement(2836921..2837958)
Genome map
AA seq 345 aa AA seqDB search
MVSFVIFIVVVALAFDFINGFHDSANSIATIVGTRVLSPLAAVIWAAVFNFSALFFVGTA
VAKSVASGFIDLNVVDANVILGGLLGAIIWNLITWWFGIPSSSSHALIGGYAGAAVAKAG
FVALLWGKKWIETLSAIVLSPALGALMGFLLMIIVFNLFRNVANAKAEKAFRVLQLTSSA
LLSLAHGGNDAQKTMGIIVGLLVATQAAFASQTGILSHFYVTSLDKIPVWVELSAYTCIS
MGTLFGGWRIVHTMGTRITKLRPVGGFCAETGGAFVILVASRFGIPVSTTHTITGAIVGV
GATNRLSAVRWGLASRIVWAWVITIPASAAMAALSYWLLAAFNPL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggtctctttcgtcatcttcatcgtcgtcgtcgcactggcgttcgacttcatcaacggt
tttcacgactccgccaactcaatcgcgacgattgttggtacgcgggtcctcagtccgctg
gcggccgtcatctgggccgctgtcttcaatttttccgcactcttctttgtcgggacggcc
gttgccaagtcggtggcctctgggttcatagatctgaacgtcgtggacgccaatgtcatc
ttgggcggactgctgggcgcgatcatctggaacctgatcacctggtggttcggcatcccg
tccagctcgtcgcacgcgctgattggggggtatgcgggtgccgcggtggccaaagccggc
ttcgtcgccctgctctggggcaagaagtggatcgaaacgctgtcagccatcgtcctgtcc
cccgcgttgggcgcgctcatgggctttctgctcatgatcatcgtgttcaacctgtttcgg
aatgtggccaacgcgaaggctgaaaaagcattccgggtcctacagctcaccagctccgcc
ttgttgtccttggcccatggcggcaatgatgcacagaagaccatgggcatcattgtgggt
ctgctggtggcaacccaggcggcgtttgccagccagacggggatcctgtcgcatttctac
gtgacctcgctcgacaagattccagtgtgggtggaattgagtgcgtacacctgcatttcc
atggggacgctgtttggtggatggcgcatcgtgcacaccatggggacgcgtatcaccaaa
cttcgtccggtgggcggtttctgcgccgaaaccggcggagcgttcgtcatcctcgtggcc
tcgcggtttggcattcccgtttcgacgacgcacaccatcactggcgccattgtcggggtg
ggggccacgaaccgcctgtcagccgtgcgatgggggctggcaagtcggatcgtatgggcg
tgggtgatcaccattcccgccagtgcggccatggcggcgttgtcgtactggttgctcgcg
gccttcaatcccctctga

DBGET integrated database retrieval system