KEGG   Gemmatimonas phototrophica: GEMMAAP_16445Help
Entry
GEMMAAP_16445     CDS       T04580                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
gph  Gemmatimonas phototrophica
Pathway
gph00540  Lipopolysaccharide biosynthesis
gph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    GEMMAAP_16445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:gph01005]
    GEMMAAP_16445
Enzymes [BR:gph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     GEMMAAP_16445
Lipopolysaccharide biosynthesis proteins [BR:gph01005]
 Unusual sugar
  GEMMAAP_16445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR ThiF
Motif
Other DBs
NCBI-ProteinID: AMW06947
UniProt: A0A143BPD2
Position
3915760..3916785
Genome map
AA seq 341 aa AA seqDB search
MSSLPLPALPPRLPSRVLVTGGAGFIGSALVWALNQLGVERIVVTDRLGRDEKWRNLVPL
RFEDYLEADDLMAPLTSGALGHFDLVLHLGACSATTELDATYLAQNNFAYTKHLAHWALG
HEVRFVYASSAATYGDGALGMDDRDNSTAGLSRLRPLNAYGYSKHLFDQYAAGMGVLPNV
VGLKYFNVYGPNEAHKADMRSLVHKAFGQIEETGRVKLFKSHRPDFRDGEQRRDFLYIKD
AIAMTLHLAMSPEAGGLYNIGSGEAHTWLELTGALFTALGKAPVIDFIEMPESIRAKYQY
HTQAEIAKLRATGYTAAVTPLADAVRDYVQGYLVGDHRLGD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcttcccctccccgcccttcctccgcgcctgccctcccgcgtgcttgtcacc
ggtggtgccggcttcattggcagtgccctcgtctgggcactgaaccagctgggcgtggaa
cgcattgtggtcaccgaccgccttggccgggacgaaaagtggcgcaacctcgtgccgcta
cggttcgaagattacctcgaggcggacgacctcatggccccactcaccagcggcgcgctg
gggcattttgacctcgtgctgcatctgggagcctgctcggcgaccaccgagttggacgcg
acctatctcgcgcagaacaacttcgcctacaccaagcatctggcgcactgggcgctgggg
catgaggtgcggtttgtctatgcgtccagcgccgccacgtacggcgacggggcgctggga
atggacgaccgcgacaacagcacggccggcttgtcccgtctgcggccgctcaatgcctac
gggtattccaagcacctgttcgaccagtatgcggcgggcatgggcgtgctgcccaacgtc
gtggggctcaagtacttcaacgtgtacggccccaacgaagcgcataaggcagacatgcgc
tctctggtgcacaaggcgttcgggcaaatcgaggagaccgggcgcgtcaagctgttcaag
tcgcaccgcccggatttccgcgacggggagcagcgccgcgacttcctgtatatcaaagat
gccatcgcaatgacgttgcacctcgccatgtcgccggaggccggtgggctgtacaacatt
ggcagcggtgaggcacacacctggctggagctcacgggggcgctctttaccgccctgggc
aaggcgccagtgattgacttcatcgagatgccggagagcattcgcgccaaataccagtac
cacacgcaggcggagatcgccaagctgcgggccaccggatacaccgcggctgtcacgccg
ctggccgatgcagtccgcgattacgtgcaggggtatctcgtaggggatcaccgcctgggt
gattga

DBGET integrated database retrieval system