KEGG   Gemmatimonas phototrophica: GEMMAAP_17475Help
Entry
GEMMAAP_17475     CDS       T04580                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gph  Gemmatimonas phototrophica
Pathway
gph00630  Glyoxylate and dicarboxylate metabolism
gph01100  Metabolic pathways
gph01110  Biosynthesis of secondary metabolites
gph01120  Microbial metabolism in diverse environments
gph01130  Biosynthesis of antibiotics
gph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GEMMAAP_17475
Enzymes [BR:gph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GEMMAAP_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AMW06093
UniProt: A0A143BN93
Position
complement(4169752..4171035)
Genome map
AA seq 427 aa AA seqDB search
MTPQDIDAFFASRDALITDQYIELEFTFECAGDPRAAAAHLASEQSTAQWQRIGVAEDFR
PQFAARVLSLVSSPRPAGFSVPVPAAPAGAVHACRAVIAHPHGNFGPRLPNLISAVLGEG
VFFAPGIPLIRLEDIRFPASYLAAFEGPQFGVQGVRDQLQVYGRPLFFGVIKPNIGLPPE
PFAQLGFEGWMGGLDVAKDDEMLADAPYSPLATRAALLGDARRRAEVATGVPKGYLANIT
DEVDALHALHDTAVAAGATMVMVNTMPVGLSGVRALRRHARVPLVTHFPFIASFSRLPLH
GVHSRVITRLQRLAGADVIIMPGFGDRMMTPEHEVMENVQACLEPMGHLKPSLPVPGGSD
SAATLEGVYRRIGSVDFGFVPGRGVFGHPMGPRGGAASLRQAWDAIAQGIPVREYAQQYA
ELRAALR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccccaggacatcgacgccttctttgcgtcccgcgatgcgctgatcacagaccag
tacatcgaactggaattcaccttcgagtgcgccggtgatccgcgcgccgcggccgcccat
ctggccagtgagcagtccacggcacaatggcagcgtatcggggtcgcggaggatttccgc
ccgcagtttgccgcccgggtgctgtcgcttgtgtcgtcaccgcgccccgcagggttctcc
gtaccggtgccagccgcgccagcgggcgccgtccacgcctgccgcgcggtcattgcgcac
ccgcacggcaatttcggcccgcgtctccccaatctgatttccgcagtgctcggcgaaggt
gtgttctttgcccccggcatcccgctcatccgactggaagacattcgttttccggcctcc
taccttgcggcgttcgaagggccgcagtttggcgtgcagggggtgcgtgaccagctgcag
gtctacgggcgcccgctcttcttcggcgtgatcaagcccaacatcggcctgccccccgag
ccgtttgcgcagttgggcttcgaagggtggatgggtgggctggatgtggccaaggacgat
gagatgctggcggatgcgccctactcgccgctcgcgacacgggccgcgttgttgggggat
gcacgtcgtcgggccgaagttgccactggtgtgcccaaaggctacctcgccaacatcacg
gacgaagtggacgcgctgcacgcgctccacgacacggccgtcgccgcaggagccaccatg
gtcatggtgaacaccatgccggtggggctgagcggagtgcgggcactccgtcgtcacgct
cgcgtgcctctggtcacccacttcccgttcattgcgtcgttcagtcggctgccgctgcac
ggcgtccactcgcgcgtgatcacccgtctacagcgtctcgccggtgccgatgtcatcatc
atgccggggttcggcgatcgcatgatgacgccggaacacgaggtgatggagaatgtgcag
gcctgtctagagcccatgggacatctcaagccgagtctgccggtgccgggaggcagtgac
tcggccgccacgctggagggggtgtaccgccgcataggatcggtggacttcggcttcgtg
ccggggcgaggggtcttcggccatcccatgggcccacgtggcggtgcggcgagtctgcgc
caggcgtgggacgccatcgcgcagggcatcccggtgcgcgaatacgcgcagcagtatgct
gaactacgggccgcgttgcgctag

DBGET integrated database retrieval system