KEGG   Geobacter pickeringii: GPICK_00355Help
Entry
GPICK_00355       CDS       T03568                                 

Definition
(GenBank) glutamate-ammonia-ligase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
gpi  Geobacter pickeringii
Brite
KEGG Orthology (KO) [BR:gpi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GPICK_00355
Enzymes [BR:gpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     GPICK_00355
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     GPICK_00355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294_C DUF294 Smoothelin
Motif
Other DBs
NCBI-ProteinID: AJE02030
UniProt: A0A0B5BBT7
Position
complement(85217..88411)
Genome map
AA seq 1064 aa AA seqDB search
MNRIDEFARRLEEALATAPGTDNDQALGALLDGEGFAYAARSATNLRLLQQVLPDHLVRQ
VAVASLVTPLPDMALNGFERVCGCVAREELLAVCSRKERLAQLLTICGSSPFLVNILSRD
PSYFHHLFPKKGIDTARSEAEMLAALRVLVPKDADYPDIFPVLRRFKFREILRIASRDLN
GLAPLEEVTAELSALAAAALQMACEVSRRALVKEHGLPMMETPAGPREAEFTIMGMGKFG
GRELNFSSDIDLIYFYSADQGETEGIADGGGTKGKLSLHAFFVKLGEMVSKAVSQVTEDG
FVFRVDLGLRPEGKSGDMACSLRSAATYYEYWGQSWERAAMLKARPVAGSLELGNQVLAA
IEPFVYRKYLDYNLIEDMMGMKKKIDASLARQQESEHNIKLGRGGIREIEFFIQALQLVY
AGKNPGLRVRNSLKALETLRDARLIADEDAAALTDAYRFLRTVEHRIQVVQERQTHSLPK
KEDEMLALARRCGYLRPNGLARFREVLEHHRGRVSAIYGGLFLSRDERLKEEVRPEIHLF
FDRQADPDLIKDMLAERGFANADAAYDNLLQLRDGPPRAHLTERASRLLEKISPLLLQEI
FASPDPDLALTNLERFLCAVGSRSSFYALLAENREILKLLVSLFATSEFLSKIFIGHPEL
LDSLVSRAYATSVKDRQAMETELNGMLEAAGDYEERLDILRRYRCEEFLRIGMTDIYGKL
GQSELTYQLTALAEVCLSAACRMAKKELARFGTPRYRDADGDLRQAHFAVVALGKMGGNE
LNYHSDLDIIYIYDHQGETDGGEKQISNREYFAKLGQKIISILTTPTREGYVYKIDTRLR
PSGNAGPLVTSLESFRTYHREEAQIWERQALTRARVVFGDERLRRSIEDVIRETVYGAGA
DESVRSEIHRLRTRMEMELARETAGSYNIKTGRGGIVDIEFMVQFLQLSHGVNHPEIRST
NTLLALKAMRLCGVLGEDDFAPLQEGYKFLRRLENRLRLIHDYSINDLGGDQKYLDALAR
RLGYDPKLRHPGTALMDEYERITGAVRGVYGRILGGGDGGKGGE
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcatcgacgagttcgcccgccgcctggaggaggcgctggccaccgctcccggc
accgacaacgaccaggcgctgggagcgctcctcgacggggagggattcgcctatgccgcc
cgctcggccaccaacctccggctcctccagcaggtgctccccgaccatctggtccgccag
gtcgccgtcgcctccctggtcaccccccttcccgacatggcgctgaacggcttcgagcgc
gtctgcggatgcgtggcgcgggaggagctcctggcggtctgcagccgcaaggaacgcctc
gcccagctcctcaccatctgcggctcgtcccccttcctcgtcaacatcctcagccgcgac
ccctcctacttccaccacctcttcccgaagaaagggatcgacacggcccgctccgaggcg
gagatgctcgccgcgctccgggtgctggtcccgaaggacgccgactaccccgacatcttc
ccggttctgcgccggttcaagttccgggagatcctccggatcgccagccgggacctgaac
ggcctcgcccccctggaggaggtgaccgccgagctctcggccctggccgccgccgctctc
cagatggcctgcgaggtctcccgccgtgccctggtgaaggagcacggcctccccatgatg
gagacccccgccggtccccgggaggcggagttcaccatcatggggatggggaagttcggc
ggccgggagctcaacttctcctccgacatcgacctgatctacttctactccgccgaccag
ggggagaccgaggggatcgccgacggcggcgggacgaaggggaagctctccctccacgcc
tttttcgtcaagctcggcgagatggtctccaaggcggtctcccaggtgacggaggacggc
ttcgtcttccgggtcgacctggggctgcgtcccgaggggaagagcggcgacatggcctgc
tcgctccgctcggccgccacctactacgagtactggggacagtcgtgggagcgggccgcc
atgctcaaggcgcgccccgtggccggttccctggagctcggcaaccaggtcctcgccgcc
atcgagccgttcgtctaccgcaagtacctcgactacaacctcatcgaggacatgatgggg
atgaagaagaagatcgacgcctccctggcccggcagcaggagagcgagcacaacatcaag
ctcggccgcggcggcatccgggagatcgagttcttcatccaggccctccagctggtctat
gccgggaaaaacccgggactgcgggtccgcaactccctcaaggcgctggagaccctacgg
gatgcccggctcatcgccgacgaggatgcggccgccctcaccgacgcctaccgcttcctc
cgcaccgtggagcaccggatccaggtggtccaggagcgccagacccactcgcttcccaag
aaggaggacgagatgctggccctggcccgccgctgcggttatctccgccccaacgggctt
gcccggttccgggaggttctggagcatcaccggggacgggtatccgccatctacggcggc
ctcttcctctcccgggacgaacggctcaaggaggaggtccgacccgagatccacctcttc
ttcgaccggcaggccgaccccgacctgatcaaggacatgctggccgagcgggggttcgcc
aacgcggacgccgcctacgacaacctgctgcagctgcgcgacggccctccccgggcccat
ctcaccgaacgggcgagccggctcctggagaagatctcgccgctccttctgcaggagatc
ttcgcctcccccgacccggacctggccctcaccaacctggagcggttcctctgtgccgtc
ggttcccgctcctcgttctacgcgctcctggccgaaaaccgggagatcctgaagctgctg
gtctccctcttcgccacctcggagttcctctccaagatcttcatcggccacccggagctt
ctggacagcctcgtctcccgcgcctatgccacctccgtcaaggaccggcaggcgatggag
acggagctgaacgggatgctggaggcggcgggcgattacgaggagcggctcgacatcctg
cgccgctaccgctgcgaggagttcctccggatcgggatgaccgacatctacggcaagctc
ggccagtctgaactcacctaccagctgacggccctggccgaggtctgcctctccgccgcc
tgccgaatggcgaagaaggagctcgcccgcttcggcacgccgaggtaccgcgacgccgac
ggcgacctccgccaggcccacttcgccgtggtggccctggggaagatgggggggaacgag
ctcaactaccactcggacctggacatcatctacatctacgaccatcagggagagaccgac
gggggggagaagcagatctccaaccgggagtacttcgccaagctcggccagaagatcatc
tccatcctcaccacccccacgcgggaggggtacgtctacaagatcgacacccggctccgc
ccctcggggaacgcggggcccctggtcacctccctggagtcgttccggacctaccaccgg
gaggaggcccagatctgggagcgccaggccctcacccgggcccgggtcgtcttcggcgac
gagcggctgcgccgctccatcgaggatgtcatccgggagacggtctacggtgccggcgcc
gacgaaagcgtgcggagcgagatccaccggctgcggacccgcatggagatggagctggcc
cgggagaccgccggcagctacaacatcaagaccgggcggggggggatcgtcgacatcgag
ttcatggtccagttcctccagctctcccacggcgtgaaccacccggagatccggagcacc
aacacgctcctcgccctgaaggcgatgcggctctgcggcgtcctcggcgaggacgacttc
gcccctctgcaggaggggtacaagttcctccgccggctcgaaaaccggctccgcctcatc
cacgactactccatcaacgacctggggggggaccagaagtacctggacgccctggcccgg
cgcctcggctacgacccgaaactgcgccatcccggcacggcgctcatggacgagtatgag
cggatcaccggcgcggtgcggggggtctacgggcggattctggggggaggcgacggaggg
aagggtggggagtga

DBGET integrated database retrieval system