KEGG   Geobacter pickeringii: GPICK_09375Help
Entry
GPICK_09375       CDS       T03568                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gpi  Geobacter pickeringii
Pathway
gpi00071  Fatty acid degradation
gpi00072  Synthesis and degradation of ketone bodies
gpi00280  Valine, leucine and isoleucine degradation
gpi00310  Lysine degradation
gpi00362  Benzoate degradation
gpi00380  Tryptophan metabolism
gpi00620  Pyruvate metabolism
gpi00630  Glyoxylate and dicarboxylate metabolism
gpi00640  Propanoate metabolism
gpi00650  Butanoate metabolism
gpi00900  Terpenoid backbone biosynthesis
gpi01100  Metabolic pathways
gpi01110  Biosynthesis of secondary metabolites
gpi01120  Microbial metabolism in diverse environments
gpi01130  Biosynthesis of antibiotics
gpi01200  Carbon metabolism
gpi01212  Fatty acid metabolism
gpi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GPICK_09375
   00630 Glyoxylate and dicarboxylate metabolism
    GPICK_09375
   00640 Propanoate metabolism
    GPICK_09375
   00650 Butanoate metabolism
    GPICK_09375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GPICK_09375
   00072 Synthesis and degradation of ketone bodies
    GPICK_09375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GPICK_09375
   00310 Lysine degradation
    GPICK_09375
   00380 Tryptophan metabolism
    GPICK_09375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GPICK_09375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GPICK_09375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GPICK_09375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gpi04147]
    GPICK_09375
Enzymes [BR:gpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GPICK_09375
Exosome [BR:gpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GPICK_09375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD PNMA
Motif
Other DBs
NCBI-ProteinID: AJE03534
UniProt: A0A0B5BEE7
Position
complement(2087714..2088889)
Genome map
AA seq 391 aa AA seqDB search
MNEVYVIESLRTPLGSFGGELSEVAAPRLAATVIRELLQRSGLPAEGVDEVIIGQVLAGG
AGQAPARQAMRYAELPDSIPAMTINKVCGSGLKALMLGAGSIRLGEADVVIAGGMENMSL
APYVLGKGRYGYRMGNGELIDLLVHDGLTDPYSGNHMGVIAEATTEKHGISRADQDAFAL
RSYQKAQAAVKEGVFRDEIVPVIKKGRKGDVTVSDDEEPFKVDFDKLTGLRGAFKKDGTV
TAGNASTINDGAALTLLASGEAVKKYGLKPKARLVASASNSQHPDQFTEAPVGAIEKALA
KAGLKASDIDLFEINEAFAAVTMLAIRQLGLDPEKVNVNGGAVAIGHPLGASGGRLTATL
VRELHRRQARYGLATLCIGGGEAVAAIFERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtctacgtaatcgaatcgttgcgcacccccctggggtctttcgggggggag
ttgtccgaggtggcggcgccgcgcctggccgcaaccgtcatccgggagctgctccagcgc
tccggcctcccagctgaaggggtggacgaggtaatcatcggccaggttctcgcggggggt
gccgggcaggccccggcccgccaggccatgcgctacgccgaactccccgactccatcccc
gccatgaccatcaacaaggtctgcggcagcggcctcaaggccctcatgctcggcgccggc
tccatccgcctcggcgaagccgatgtggtcattgccggcggcatggagaacatgtccctg
gccccctacgtgcttggcaaggggcgctacgggtaccgcatggggaatggcgagctgatc
gacctgctggtccatgacggcctcacggacccctacagcggcaatcacatgggagtcatc
gccgaggccaccaccgagaagcacggcatctcccgcgccgaccaggatgcctttgccctg
cgctcctaccagaaggcccaggcagcggtaaaggaaggggtcttccgggatgagatcgtc
ccggtgatcaagaagggacgcaagggggacgtgaccgtcagcgacgacgaagagccgttc
aaggtggacttcgacaaactcaccggactgcgtggcgccttcaagaaagacggcaccgtc
accgccggcaacgcctccaccatcaacgacggcgcagccctgacgcttctggccagcggg
gaggcggtgaagaaatacggcctcaagcccaaggcccggctggtggcctctgcttccaac
agccagcatccggatcagttcaccgaggcaccggtgggggccatcgaaaaggcccttgcc
aaggcaggactcaaagccagtgatatagacctcttcgagatcaacgaagcctttgcagcc
gtgaccatgcttgccatccggcagctggggctcgatccggaaaaggtcaacgtcaacggc
ggggccgtggccatcggccatcccctgggggcaagcggcgggcgcctgaccgctaccctg
gttcgggagctgcaccggcgccaggcccgctacggcctcgccacgctttgtattggcggc
ggcgaagcggtggcggcaatctttgagcgggtctag

DBGET integrated database retrieval system