KEGG   Gordonia polyisoprenivorans: GPOL_c09380Help
Entry
GPOL_c09380       CDS       T01719                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase AceA
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00630  Glyoxylate and dicarboxylate metabolism
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo01200  Carbon metabolism
Module
gpo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GPOL_c09380 (aceA)
Enzymes [BR:gpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GPOL_c09380 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFA72001
UniProt: H6MZL4
Position
1087747..1089033
Genome map
AA seq 428 aa AA seqDB search
MSNVGKPRTAAEIQQDWDTNPRWKGITREYTADQVVELQGSVVEDPTLARRGAEILWEGV
NGDNYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPSV
VRRINNALLRADEIAKVEGDTSVDNWVVPIVADGEAGFGGALNVYELQKAMIAAGAAGTH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVAGAPTVVIARTDAEAATLITSD
VDERDKPFLDGTRTAEGFYGVKKGIEPCIARAKAYAPYSDLIWMETGKPDLELARKFAEA
VKSEFPDQLLAYNCSPSFNWKQHLDDATIAKFQNELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDKIATTVDPNTSTAALKG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtcggaaagccccgtaccgccgcggagatccagcaggactgggacaccaac
ccgcgctggaagggcatcacccgcgaatacaccgccgaccaggtcgtcgagctgcagggc
tcggtcgtcgaggaccccaccctggcccgtcgtggcgccgagatcctctgggagggtgtc
aacggcgacaactacatcaacgcgctcggtgccctcaccggcaacatggccgttcagcag
gtgcgcgccggcctcaaggccatctacttgtccggctggcaggtcgccggtgacgcgaac
ctctccggtcacacctaccccgaccagtcgctctacccggccaactcggtgccgtcggtc
gtgcgccgcatcaacaacgcgctgctgcgcgccgatgagatcgccaaggtcgagggcgac
acctcggtcgacaactgggtcgtgccgatcgtcgccgacggcgaggccggcttcggtggc
gcgctcaacgtctacgagctgcagaaggccatgatcgccgcgggtgccgccggtacccac
tgggaggatcagctcgcctcggagaagaagtgcggccacctcggtggcaaggtgctcatc
cccacccagcagcacatccgtaccctgacctcggctcgtctggccgccgacgtcgccggc
gcgccgaccgtcgtcatcgcccgcaccgacgccgaggccgcaaccctgatcacctccgac
gtggacgagcgcgacaagccgttcctcgacggcacccgcaccgcggagggcttctacggc
gtgaagaagggcatcgagccctgcatcgcccgcgccaaggcctacgccccgtactccgac
ctgatctggatggagaccggcaagcccgacctggagctggcccgcaagttcgccgaggcc
gtcaagagcgagttcccggaccagttgctggcctacaactgctccccgtcgttcaactgg
aagcagcacctcgacgacgcgaccatcgcgaagttccagaacgagctcggcgcaatgggt
ttcaagttccagttcatcacgctggccggcttccacgccctcaactactcgatgttcgat
ctggcctacggctacgcccgcaaccagatgagtgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgcggttacaccgccaccaagcaccagcgtgaggtcggtgccgga
tacttcgacaagatcgccaccaccgtcgatcccaacacctcgaccgcagccctcaagggc
tcgaccgaggaaggtcagttccactag

DBGET integrated database retrieval system