KEGG   Gordonia polyisoprenivorans: GPOL_c10490Help
Entry
GPOL_c10490       CDS       T01719                                 

Definition
(GenBank) putative uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00860  Porphyrin and chlorophyll metabolism
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
Module
gpo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GPOL_c10490
Enzymes [BR:gpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     GPOL_c10490
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GPOL_c10490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AFA72111
UniProt: H6N0K7
Position
1204720..1206459
Genome map
AA seq 579 aa AA seqDB search
MSRTTKKANPGRIFFVGSGPGDPDLLTVRARSVITSATTAYVDPDVPATVVAMIGAAHRE
EPADDQRKPAKQTAEKSGAEKSGAEKSGSDVAADGAATEAKPADSESAADQRVEADHADT
DADQVVRPALGDPGEVAKTLVAAAKAGDDVVRVVSGDPLTTDSVLTEVHAVARTSVTFEV
LPGLPAASVVPSYAGMPLGSSHTVADVRAEGVDWAALAASPGPLVLHATSGHLAETASAL
TEHGLAPQTPVAITINGTTCAQRTIEATLATLNEQGNALTGPLILTVGKVVSQRGKLSWW
ESRALYGWTVLVPRTKDQAADMSERLVGHGAIPKEVPTIAVEPPRSPAQMERAVKGLVDG
RYQWVVFTSTNAVRAVWEKFAEFGLDARAFSGVKIACVGEATAERVRAFGINPELVPSGE
QSSLGLLEDFPPYDDVFDPVDRILLPRADIATETLSEGLRERGWEIDDVTAYRTVRAAPP
PAETREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPKTAETATEFGLRVDV
QPENASIPDLVDALAEHAARLRAEGALPPPRKKSRRSRS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtacgaccaagaaggccaatccggggcggatctttttcgtgggatcggggccc
ggggacccagacctgctgaccgtccgggcgcggagcgtcatcacctccgcgaccactgcc
tacgtcgaccccgacgtaccggccacggtggtcgccatgatcggtgccgcgcaccgcgag
gagcccgccgacgaccagcgtaaaccggcgaagcagaccgcagagaagtcgggcgcagag
aagtcgggcgcagagaagtcggggtccgacgtggccgccgacggcgccgcgaccgaggcc
aagcccgccgactccgagtcggccgccgaccagcgcgtcgaggccgaccacgccgatacc
gatgccgatcaggtggttcgcccggcgctcggcgatcccggtgaggtcgccaagaccctc
gtcgcggccgccaaggccggtgacgacgtggtgcgcgtggtctccggggacccactgacc
accgactcggtgctcaccgaggtccatgccgtggcgcgcacctcggtcaccttcgaggtg
ctgccgggcctgcccgcggcttcggtggtgcccagctacgccggtatgccgctcggctcc
agtcacaccgtggccgacgtccgcgccgagggcgtcgactgggcggcgctggccgcgtca
ccgggaccgctggtgctgcacgcgacgtcggggcacctggccgagaccgccagtgcactg
accgagcacgggctggccccgcagacaccggtcgcgatcaccatcaacggcaccacctgc
gcgcagcggaccatcgaggccacgctggccacgctcaacgagcagggcaacgcgctgacc
ggtccgttgatcctcaccgtgggcaaggtcgtcagccagcgcggcaagctctcctggtgg
gagtcgcgcgcgctctacggctggacggttctggtgccgcgcaccaaggatcaggccgcc
gacatgagtgagcgcctcgtcgggcacggcgcgatcccgaaggaagtaccgaccatcgcg
gtcgagccgccgcgcagtccggctcagatggaaagggccgtcaagggtttggtggacgga
cgctaccagtgggtggtgttcacctccaccaacgcggtgcgcgcggtctgggagaagttc
gccgagttcggactggatgcgcgagcgttctccggggtcaagatcgcctgtgtcggagag
gccacggccgagcgggtgcgggccttcgggatcaatcccgagctcgtgccgtcgggggag
cagtcctcactcggtctgctcgaggacttcccgccgtatgacgacgtgttcgatccggtg
gaccgaatcctgttgccgcgggccgatatcgccaccgagaccctctcggagggactgcgt
gagcgtggctgggagatcgacgacgtcaccgcctatcgcacggtgcgtgcggccccgccg
cccgccgagacccgcgagatgatcaagaccggcggtttcgatgcggtctgcttcacctcg
agctcgacggtccgcaatctcgtcggtatcgccggaaagccgcacgcgcgcaccatcgtt
gcgtgtatcggtcccaagaccgcggaaacggcaacggaattcgggcttcgcgtcgacgtg
cagccggagaacgcgtccattccggacctcgtggatgcactcgccgagcacgccgcccga
ctgcgggccgagggggcgttgcccccgccgcgcaagaagtcgcggcggtcgcggtcctag

DBGET integrated database retrieval system