KEGG   Gordonia polyisoprenivorans: GPOL_c12500Help
Entry
GPOL_c12500       CDS       T01719                                 

Definition
(GenBank) nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00040  Pentose and glucuronate interconversions
gpo00052  Galactose metabolism
gpo00500  Starch and sucrose metabolism
gpo00520  Amino sugar and nucleotide sugar metabolism
gpo01100  Metabolic pathways
gpo01130  Biosynthesis of antibiotics
Module
gpo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GPOL_c12500
   00052 Galactose metabolism
    GPOL_c12500
   00500 Starch and sucrose metabolism
    GPOL_c12500
   00520 Amino sugar and nucleotide sugar metabolism
    GPOL_c12500
Enzymes [BR:gpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GPOL_c12500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: AFA72308
UniProt: H6N3E9
Position
1447866..1448816
Genome map
AA seq 316 aa AA seqDB search
MTSVSNSTTEIPEYHDVPDTPPIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIEL
VAEEAKSAGAERLLIITSPGKDGVVAHFVEDLVLENTLAKRGKAAMLAKVRKAPSLLDVA
SVIQDKPLGLGHAVGCVEDYLDDDEDAIAVLLPDDLVLPGGVLEVMARTRQRRGGSVLCA
IEVPGDRISAYGVFDVEDLPDANNPNVKRLKGMVEKPAPEEAPSNLAAAGRYILDRKIFD
ALRRIKPGAGGELQLTDAIALLIEEGEPVHVVVHHGTRHDLGNPGGYLKAAVDFALDRDD
YGPDLREWLTERLKQD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgtgagtaattcgacgaccgagattcccgagtaccacgacgtacccgacacc
ccgccgatcccacgtaccgcggtggtcccggccgcgggtctgggcacacgattcctgccg
gcgaccaagacggtgcccaaggagttgctgcccgtcgtcgatacccccggcatcgaactc
gtcgccgaggaggccaagtccgccggtgccgaacggctgctgatcatcacctcacccggc
aaggacggcgtggtcgcgcacttcgtcgaagacctggtgctggagaacacgctggccaag
cgcggcaaggcggcgatgctcgccaaggtccgcaaggcaccgtcgctgctggacgtggcc
tcggtgatccaggacaagccgctcggtctcggccatgccgtcggatgcgtcgaggactac
ctcgacgacgacgaggacgcgattgcggtgctgctgcccgacgatctggtgttgcccggt
ggggtgctcgaggtgatggcccgtacccgacaacgacgcggcggatcggtgctgtgtgcc
atcgaggtccccggcgaccggatcagtgcctacggcgtcttcgacgtcgaggacctgccc
gacgccaacaacccgaacgtcaagcgcctcaagggcatggtcgaaaagcccgcacccgag
gaggcgccgtcgaacctcgcggccgccggccgatacatcctcgaccgcaagatctttgac
gcgctgcgccgcatcaagcccggtgcgggtggcgaattgcagctgaccgacgcgatcgcc
ctgctcatcgaggaaggtgagccggtgcacgtggtcgtccatcacggcacccgtcacgac
ctcggcaaccccggcggctacctgaaagcggccgtcgacttcgccctcgaccgcgatgac
tacggtcccgacctgcgcgagtggctcaccgagcgcctcaagcaggactga

DBGET integrated database retrieval system