KEGG   Gordonia polyisoprenivorans: GPOL_c21860Help
Entry
GPOL_c21860       CDS       T01719                                 

Definition
(GenBank) aldose 1-epimerase-like enzyme
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00010  Glycolysis / Gluconeogenesis
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPOL_c21860
Enzymes [BR:gpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     GPOL_c21860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFA73218
UniProt: H6MZW7
Position
complement(2471547..2472434)
Genome map
AA seq 295 aa AA seqDB search
MTTSGDDATQQFHGVRRGTVHGLDAHLIETPHAQAAISVFGGQVVSFRPFGSAHDAVWVS
PVLADLPTPIRGGIPVCWPYFAREGQTGDVPSHGYARTARWAITGAVVTETGEVEISLAP
EGLDQLELRLSMTVRVGATLEQGIHTHNPGTAPARLTEALHNYFRVSDVADVRVEGLAGL
TYADKFDGGAIHPQHGEWTLPSYPARSDRLYPGAGGTYRIVDPGFGRVIEIRGRQARTAV
VWNPGADVAAGMADVGPHWREFVCVETANAGPDVVEVPAGATHSMWQTISVTPVS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacatcgggtgacgacgcaacgcagcaattccacggggtccgcaggggcaccgtt
cacgggctcgacgcccacctcatcgagacgccgcacgcgcaggcggcgatctcggtgttc
ggcgggcaggtcgtgtcgttccggcctttcgggtcggctcacgacgcggtgtgggtgtcc
ccggtgttggccgatctgccgacgcccatccgcggcggaatcccggtctgctggccctat
ttcgctcgcgagggccagaccggcgacgttccctcgcacggttacgcgcgcaccgcccga
tgggcgatcacgggagcggtggtcaccgagaccggcgaagtcgagatctcgttggcacca
gagggactcgaccagctcgagttgcgcctgtcgatgaccgtgcgggtcggcgctacgttg
gagcagggtatccacacccacaacccgggcacagcgcctgcgcggctcaccgaagctctg
cacaactactttcgcgtctccgatgtcgctgatgtccgcgtcgaggggttggccgggctg
acctatgccgacaagttcgacggcggcgcgatccatccgcagcacggcgaatggacgttg
ccgagttaccctgcgcgcagcgaccgcctgtacccgggggcgggcggcacctaccggatc
gtcgaccccggcttcggtcgggtcatcgagatccgtggacgccaggcgcgcacggccgtc
gtctggaatcccggcgccgacgttgccgcgggcatggccgacgtcggtccgcactggcgc
gagttcgtgtgtgtcgagacggccaatgccggccccgacgtcgtcgaggttcccgccggg
gccacccactccatgtggcagaccatctccgtcacgcccgtctcataa

DBGET integrated database retrieval system