KEGG   Gordonia polyisoprenivorans: GPOL_c38370Help
Entry
GPOL_c38370       CDS       T01719                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00020  Citrate cycle (TCA cycle)
gpo00640  Propanoate metabolism
gpo00660  C5-Branched dibasic acid metabolism
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo01130  Biosynthesis of antibiotics
gpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GPOL_c38370 (sucC)
   00640 Propanoate metabolism
    GPOL_c38370 (sucC)
   00660 C5-Branched dibasic acid metabolism
    GPOL_c38370 (sucC)
Enzymes [BR:gpo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GPOL_c38370 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFA74849
UniProt: H6N4R0
Position
complement(4373009..4374172)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHGVPTTPGRVTDSAADARTIAEEIGKPVMIKAQVKVGGRGKAGGVK
YSKDADEAQANAENILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGVEIEVTAEQNPDALARVPVDAVKGVDLAFAREIAEKGKLPAEVLDAAANTIQKLWEVF
IAEDATLVEVNPLVRTPDDQILALDGKVTLDENADFRHPDHEAFADRDATDPLELKAKEN
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHKGVKPANFLDIGGGASAEVMAAGLD
VILGDEQVKSVFVNVFGGITACDAVANGIVGALNKLGDEANKPLVVRLDGNKVDEGRKIL
ADANHPLVTLAETMDSGADKAAELASK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaggaactgttcgccaagcacggagttccgaccaca
cccggtcgtgtaaccgactctgccgccgacgcgcgcacgattgccgaggaaatcggcaag
cccgtcatgatcaaggcgcaggtgaaggtcggtggacgtggcaaggccggcggcgtgaag
tactccaaggacgccgacgaggcgcaggcgaacgccgagaacatcctcggtctcgacatc
aagggccatgtcgtcaagaaactcctcgtcgccgaggccagcgacatcgccgaggaatac
tacatctccttcctcctcgatcgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcgtggagatcgaggtgaccgccgagcagaaccccgacgcgctcgcccgcgtcccg
gtcgacgccgtcaagggtgtcgacctcgcattcgctcgcgagatcgccgagaagggcaag
ctgcccgccgaggtgctcgacgccgccgccaacaccatccaaaagctctgggaggtgttc
atcgccgaggacgccaccctcgtggaggtcaatcctctggtccgtacccccgacgaccag
atcctggccctcgacggcaaggtcaccctcgatgagaacgccgacttccggcatcccgac
cacgaggccttcgccgaccgcgacgccaccgatccgctggagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggacaggtcggcatcatcggcaacggcgccgggctg
gtcatgagcaccctcgacgtggtcgcctacgccggtgagaagcacaagggtgtcaagccc
gcgaacttcctcgacatcggtggcggcgcctcggccgaggtgatggccgccggtctcgac
gtcatcctcggcgacgagcaggtcaagagtgtcttcgtcaacgtcttcggcggcatcacc
gcctgcgacgctgtcgccaacggcatcgtcggcgcgctgaacaagctcggcgacgaggcc
aacaagccgctcgtcgtccgcctcgacggcaacaaggtcgacgaaggccgcaagatcctg
gccgatgcgaatcaccccttggtgacgctcgccgaaacgatggactccggcgccgacaag
gccgccgaactggcgagcaagtga

DBGET integrated database retrieval system