KEGG   Gordonia polyisoprenivorans: GPOL_c41180Help
Entry
GPOL_c41180       CDS       T01719                                 

Gene name
hsaG
Definition
(GenBank) acetaldehyde dehydrogenase HsaG
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00360  Phenylalanine metabolism
gpo00362  Benzoate degradation
gpo00620  Pyruvate metabolism
gpo00621  Dioxin degradation
gpo00622  Xylene degradation
gpo00650  Butanoate metabolism
gpo01100  Metabolic pathways
gpo01120  Microbial metabolism in diverse environments
gpo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GPOL_c41180 (hsaG)
   00650 Butanoate metabolism
    GPOL_c41180 (hsaG)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GPOL_c41180 (hsaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GPOL_c41180 (hsaG)
   00622 Xylene degradation
    GPOL_c41180 (hsaG)
   00621 Dioxin degradation
    GPOL_c41180 (hsaG)
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GPOL_c41180 (hsaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh TrkA_N GFO_IDH_MocA Sacchrp_dh_NADP NAD_binding_3 DUF4620
Motif
Other DBs
NCBI-ProteinID: AFA75125
UniProt: H6MT04
Position
complement(4689455..4690360)
Genome map
AA seq 301 aa AA seqDB search
MAAKLTAAIIGSGNIGTDLMYKLERSEVIAPRWMVGIDADSEGMKRAADHGLITMSGGAD
ELLSSSEKPDLIFEATSAYVHREYAPRYEQAGITAVDLTPAAVGPAVVPPANLREHLDAP
NTNMITCGGQATIPMVHAVSSVVPVPYAEIVASVASVSAGPGTRANIDEFTRTTSKGIET
IGGAARGKAIIILNPADPPMIMRDTIFCAIPDDADTDAIAESIRKREKEIQAYVPGYRLL
QDPQFDPPSVLNGGHARVSIFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAKQKLGVS
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccaagctgaccgcggcgatcatcgggtcgggcaacatcggtaccgacctgatg
tacaagctggaacgatccgaggtgatcgctccccgatggatggtcgggatcgatgccgac
tcggagggcatgaagcgggccgccgaccacgggctcatcacgatgagcggcggcgccgac
gagttgctctcgtcgtcggagaaaccggacctgatcttcgaggcgacgtcggcctatgtg
caccgcgaatacgcgccgcgatacgagcaagcgggtatcaccgcggtcgacctgacgccg
gcggcggtgggcccggcagtggtgccgccggccaatctgcgcgagcacctcgacgcaccg
aacaccaacatgatcacctgcggtgggcaggcgacgatcccgatggtccacgcggtgtcc
tcggtggtgccggtgccctacgccgagatcgtcgcatcggtcgcatcggtgtcggcaggt
ccggggacgcgggccaacatcgacgagttcacccggaccacatcgaaggggatcgagacg
atcggcggtgccgcgcgcggcaaggcgatcatcatcctcaatccggccgatccgccgatg
atcatgcgcgacaccatcttctgcgccatccccgacgacgccgacaccgatgccatcgcc
gagtcgatccgcaagcgggagaaagagatccaggcctacgtgcccggctatcgactactg
caggacccgcagttcgatccgccgagtgtgctcaacggcggccacgcccgcgtctcgatc
ttcgtcgaggtcgagggcgccggggacttcttgccgccgtacgccggcaacctcgacatc
atgaccgccgcagccaccaaggtcggcgaggaaatcgcgaagcagaagttgggggtttcg
gcatga

DBGET integrated database retrieval system