KEGG   Paraglaciecola psychrophila: C427_0978Help
Entry
C427_0978         CDS       T02535                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
gps  Paraglaciecola psychrophila
Brite
KEGG Orthology (KO) [BR:gps00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C427_0978 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGH43087
UniProt: K7ADP8
Position
complement(915462..915836)
Genome map
AA seq 124 aa AA seqDB search
MKQLNKVKITVETQYLKNQIPDKDKYVFAYKISVHNNGQHSVQLINRYWLITDGNGKKTE
VEGPGVIGLQPHILPGDFFQYTSGAVLDTPVGTMQGYYEMQQEDGGRFEAVINVFSLAVP
NVVN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattgaataaagttaagattacagtagaaactcagtatctaaaaaaccagata
cctgataaagataaatatgtttttgcatataagatttcggttcacaataatggccagcat
tcggttcagcttatcaatcgatactggttaataaccgatggcaatggcaaaaaaacagaa
gtagaaggccctggagtcataggcttacaaccgcacatcctgcctggtgatttttttcaa
tacaccagtggagctgtgttagatacccccgtgggaacaatgcaaggctattacgaaatg
caacaagaagatggcggacggtttgaagctgttatcaacgtttttagcctagcagttcct
aacgtagtcaactaa

DBGET integrated database retrieval system