KEGG   Paraglaciecola psychrophila: C427_1828Help
Entry
C427_1828         CDS       T02535                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00071  Fatty acid degradation
gps00072  Synthesis and degradation of ketone bodies
gps00280  Valine, leucine and isoleucine degradation
gps00310  Lysine degradation
gps00362  Benzoate degradation
gps00380  Tryptophan metabolism
gps00620  Pyruvate metabolism
gps00630  Glyoxylate and dicarboxylate metabolism
gps00640  Propanoate metabolism
gps00650  Butanoate metabolism
gps00900  Terpenoid backbone biosynthesis
gps01100  Metabolic pathways
gps01110  Biosynthesis of secondary metabolites
gps01120  Microbial metabolism in diverse environments
gps01130  Biosynthesis of antibiotics
gps01200  Carbon metabolism
gps01212  Fatty acid metabolism
gps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C427_1828
   00630 Glyoxylate and dicarboxylate metabolism
    C427_1828
   00640 Propanoate metabolism
    C427_1828
   00650 Butanoate metabolism
    C427_1828
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C427_1828
   00072 Synthesis and degradation of ketone bodies
    C427_1828
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C427_1828
   00310 Lysine degradation
    C427_1828
   00380 Tryptophan metabolism
    C427_1828
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C427_1828
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C427_1828
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C427_1828
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gps04147]
    C427_1828
Enzymes [BR:gps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C427_1828
Exosome [BR:gps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C427_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGH43937
UniProt: K7A4Q0
Position
1725519..1726700
Genome map
AA seq 393 aa AA seqDB search
MKEAVIVSTARTPIGRAYKGAFNNLEAPSLGGHAIREAVRKSGIDPASVDDVIMGSALTQ
GSGGMNIGRMAGLAGGLPTSVSGMTLDRQCSSGMYAIATAAKHIITDNVPVMVAGGLDSI
SLVQNKAMNTHRIVDPALAKMHKNIYMPMLQTAEVVAARYGISRDVQDEYAYRSQMRTAA
AQAAGKFDDEIVPVTATKVIIDRETKVESFQEVTLSKDEGNRAETTLEGLQNLKPVIEGG
VITAGNASQLSDGASASVIMSSKLAEQQNLTPLGAYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMNDIGLWELNEAFAVQVLYCRDKLGIDDSILNVNGGAISVGHPYGMSGARMVG
HALIEGKRRGAKFVVCTMCIGGGMGAAGLFEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagtcattgtatcaaccgctagaactcccatcggccgtgcctataaaggc
gcgtttaataacctggaagcgccaagtttaggtggccatgctatccgtgaagcagtaagg
aagtctggtattgatcctgccagtgtagatgatgtgatcatgggcagtgccttaactcaa
ggtagtggcggcatgaatataggacgtatggctggtttagctggtggtttacccacgtca
gtgtcaggtatgactcttgaccgccaatgtagctcaggaatgtatgcaattgctacagcg
gcaaaacacatcattacagacaacgtgccagtaatggttgctggtggacttgattcgatt
agtttagtgcaaaacaaggcaatgaatactcatcgtatcgttgacccagccctggctaaa
atgcataaaaatatctatatgccaatgttacaaacagctgaagtggtcgctgctcgttat
ggtattagtcgtgatgtgcaagacgaatatgcttatcgcagccaaatgcgcacggcagcg
gctcaggctgcaggtaaatttgatgatgaaattgtgcccgtaactgcaaccaaagtaatc
attgaccgcgaaacgaaagttgaaagctttcaagaagtgactttgagtaaagatgaaggc
aaccgtgctgaaaccacattagaaggtttacaaaatttaaagcctgttatcgaaggtggt
gttatcactgcaggtaatgctagtcagttatctgacggcgcatctgccagtgtaataatg
agcagcaagttagctgaacaacaaaacttgacaccattaggtgcttatcgcggtattgct
gtggcaggttgtgaacctgatgaaatgggtattggtccggttttcgctattccaaaatta
ctcaagcagcacggcttaacgatgaatgatattggattgtgggagctgaacgaagccttt
gcggtacaagttttatattgccgtgacaagttaggtattgatgacagtattttaaatgta
aacggtggcgctatttctgtaggtcatccttacggaatgagtggcgcacgtatggttggt
catgcactgattgaaggtaagcgccgtggtgctaaatttgttgtgtgcaccatgtgtatc
ggtggcggaatgggtgctgcaggtttatttgaagtttattaa

DBGET integrated database retrieval system