KEGG   Paraglaciecola psychrophila: C427_1924Help
Entry
C427_1924         CDS       T02535                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00900  Terpenoid backbone biosynthesis
gps01100  Metabolic pathways
gps01110  Biosynthesis of secondary metabolites
gps01130  Biosynthesis of antibiotics
Module
gps_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C427_1924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:gps01006]
    C427_1924
Enzymes [BR:gps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     C427_1924
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     C427_1924
    2.5.1.29  geranylgeranyl diphosphate synthase
     C427_1924
Prenyltransferases [BR:gps01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   C427_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGH44033
UniProt: K7A2J7
Position
complement(1830388..1831245)
Genome map
AA seq 285 aa AA seqDB search
MIQTEVNMQCQSLFLLKQCEEDMLFRLKGNEPSCFHLASGGGRTRAKLCIEAGLALQLPE
KTIVALACAIELLHNASLVHDDLQDADITRRGRQSVWKKFGKSHAVCAGDLMISAAFGSL
ANVESYSSLPSLLIQIQEAVSLTVRGQSRDLDTQTTITEHEYEDIAAMKSGPLIQLTLTL
PLIAAGYDDHIKTVNEALNKFSIAYQILDDLDDWQQDLQREQLNIVNLLVSRYSLVESIT
IARNRVHYLLNRCQRELNALPSNCAASVITATHNLLAKAKVDLNE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaccgaagtaaatatgcaatgccaatctttattcttattgaagcagtgtgaa
gaagacatgctttttcgattaaaaggcaatgaaccttcatgttttcatttggcaagtggt
ggaggtagaacccgcgcaaaattgtgtattgaagcaggattagcacttcagctacctgaa
aaaacgatcgttgctttggcctgtgccattgagttacttcacaatgcctcactcgttcat
gacgacctgcaagatgctgatatcactcgtagaggacgtcaatctgtatggaaaaaattc
ggcaagtctcacgcagtttgtgcaggtgatctgatgatttccgcggcttttggttcgtta
gctaatgtagaatcttatagttcattaccttccctattgattcagattcaagaggctgtt
tcgctaacagttagaggacagtccagagaccttgatactcagacaacaataactgagcac
gagtacgaagacatagccgcaatgaagtcaggtccgttaatccagctgacattaactttg
ccactcatcgctgctggctacgatgaccatatcaaaacagttaatgaggcacttaacaag
ttctcaatcgcctatcagatacttgatgacctagatgattggcaacaagacctacaaaga
gagcagcttaatatagtgaatctactggtatcccggtattctttagtagaatccataact
attgctcgcaatcgtgttcattatttattgaaccgttgtcaaagagaacttaacgcactc
ccctctaactgcgcagcatcagttattaccgctactcacaacctattagcaaaagccaag
gtagacttaaatgaataa

DBGET integrated database retrieval system