KEGG   Paraglaciecola psychrophila: C427_3394Help
Entry
C427_3394         CDS       T02535                                 

Definition
(GenBank) glycoside hydrolase family protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00460  Cyanoamino acid metabolism
gps00500  Starch and sucrose metabolism
gps01100  Metabolic pathways
gps01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C427_3394
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    C427_3394
Enzymes [BR:gps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     C427_3394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like SKA1
Motif
Other DBs
NCBI-ProteinID: AGH45503
UniProt: K7A764
Position
3249650..3251881
Genome map
AA seq 743 aa AA seqDB search
MSSSLSNEVSIEPHSRSAEPDMLVGILDSMTVQEKIGQMSQIFSHSEHITEHLAYSIRQG
RVGSILNEVRLHTVNELQRLAVEESRLGIPLLIGRDVIHGFNTIFPIPLGQAASWCVETV
KQCAHISALEAASVGVNWTFAPMIDISRDPRWGRIAESLGEDPYLCSVLGVAMLQGFQGD
ELHKNGSIAACAKHFAGYGAGESGRDYSTTNIPENELRNVYLPPFKAAADAGVATFMAAF
SDLNGVPASGNKWLMTDILREEWDYKGFVVSDWESVIQLTTHGFSKDNKDAAYEAANAGI
DMEMVSSAYFEHLPDLVAEGRIDMRQINNAVKKILHLKWQLGLFDSPYTDASLLPKPLNS
QNLQAAKDAAIKSCVLLKNDKNILPLSAGSLHSVAIIGPLADDPYEQLGTWIFDGDPQHS
QTCLTAITQELSGKANIHHVKAMQTSRSHDQADFKQAVKSASTADVAILILGEESILSGE
AHCRAEIDLPGCQEQLINAIAETGTPIVLVIMAGRPLTIETVLPKVDAVLFAWHPGTMGG
PAIADLLFGKACPSGKLPVTFPRKVGQVPIYYAQKHSGKPATEQAFIHMDNIPVHSPQTS
LGMAATHLDTHFSPLFPFGFGLSYTQFSYQNLELSHKTLKLGETLVVRVLLTNVGDTDGE
EIAQLYIRDLVGSVTRPVKELKDFKRVKLTAGKNEWVTFELSTDKLAFYDRNMQLKTETG
QFHLWLGACSQTGLKDEFEIIDD
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaagtctttcaaacgaagtatcaattgagccccactcgcgctccgctgaaccc
gatatgttggtcggtattttggatagtatgacagtgcaagaaaaaattggccaaatgagt
cagatttttagtcactcggaacatataactgaacaccttgcctactcgattcgccaaggc
cgggtaggctcgatacttaatgaagttagactacacacggtaaatgagttacaacgtcta
gcagtggaagaaagtcgactaggcattcctctgctaattggtcgtgatgtaatccatggt
tttaacactatatttccaatccctttgggacaagccgcaagttggtgcgttgaaacggtc
aagcaatgcgctcatatcagtgcactagaggctgcctctgtaggtgttaattggaccttt
gcgccaatgatcgatattagccgggatccgcgttggggtagaattgcagaaagtttaggt
gaagatccttatttatgttctgtcctaggtgtcgccatgttgcaaggttttcagggtgat
gaattacataaaaatggcagtattgcggcctgcgccaaacatttcgcaggatacggtgcg
ggtgaaagtggtcgtgattacagcaccactaatattccagaaaatgaacttcgcaatgta
tatctgccgccatttaaagcagctgccgatgcgggtgtcgccacgtttatggcagctttt
agcgatctaaatggtgtgcccgcctcaggtaataagtggttaatgactgacatattgcgt
gaagaatgggattacaaaggctttgtagttagcgattgggagtcagttatacaattaacg
actcatggtttcagcaaagacaacaaagacgcagcttacgaagccgcaaatgctgggatt
gatatggaaatggttagctccgcatattttgagcacttaccagatttagtagccgaaggc
cgcatagacatgcgacaaattaacaacgcggtcaaaaaaatattacaccttaagtggcag
ttaggcttatttgactctccgtacactgatgcaagcttgctacctaaacctctcaactcg
caaaatttacaggcagccaaagatgctgcaatcaaaagttgtgtgttgctcaaaaatgat
aaaaatatactgccactatcagcaggttctttacactcagtcgctattattgggccatta
gcggatgatccttatgagcaactaggcacctggatatttgacggtgatccccagcacagt
caaacctgtttaaccgctattacacaagaattgtcaggtaaggccaatattcatcatgtt
aaggcgatgcaaacatctcgcagtcatgatcaggctgactttaaacaggcagttaaatcg
gcttccactgcagatgtagccatattaattttaggtgaagagtccatcttatcaggcgaa
gctcattgccgagctgaaattgatttacccggttgccaagagcagttaatcaacgctatc
gccgaaacaggcacgcccattgtgttagtgatcatggccggtagacccttaacgatagaa
acagtattgcctaaagtagatgcggttttgtttgcttggcatccaggcacaatgggtgga
cccgccatcgcagatttattatttggtaaagcctgtccctcaggtaagttgcccgttacc
ttccccagaaaagtaggacaagtgccgatttactacgcacaaaaacattctggcaagcct
gcaacggaacaggcttttatacacatggataatatacctgtgcattcaccgcaaacctca
cttggtatggccgccactcatttagacactcattttagtcccttatttccatttggtttt
ggcctttcttatactcaatttagttatcaaaaccttgagcttagccacaaaacattaaag
ctaggcgagacattagtggttcgtgtgttgttgactaacgttggcgatactgatggcgaa
gaaatagcacagttgtatattcgcgatctagtgggcagtgtgacccgcccagtcaaagaa
ttaaaagattttaagcgtgtaaagctcactgctggcaaaaatgaatgggtcacatttgaa
ctgagtactgataaactggcgttttatgataggaatatgcagcttaaaacagagactgga
caatttcatctttggttgggggcttgttcacaaactgggctgaaggatgagttcgagata
attgatgattaa

DBGET integrated database retrieval system