KEGG   Paraglaciecola psychrophila: C427_4377Help
Entry
C427_4377         CDS       T02535                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00520  Amino sugar and nucleotide sugar metabolism
gps01100  Metabolic pathways
gps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C427_4377 (nagA)
Enzymes [BR:gps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     C427_4377 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 HbrB
Motif
Other DBs
NCBI-ProteinID: AGH46479
UniProt: K7AA56
Position
complement(4225882..4227042)
Genome map
AA seq 386 aa AA seqDB search
MNTLKSPNRILTKALFDGANHHYDKVLSVLKGVIVAVDNDISNHDVALDGLVVPGYVDLQ
VNGGGGLLFNANPSIDSLKKMMQAHSQFGTTAMLPTIITDNLKTMIRAADTISHAIKDNM
LGILGIHFEGPHISITKKGAHSQEFIRSISEEEWKIFERKDIGHVLVTLAPEVLPIEDIK
RLVSMGVHVCIGHSNATYEITNRAIEAGATGFTHLYNAMSAITGREAGVTGSALLNDHTQ
CGLIVDGHHVSVASCKLALKVKPVGGIFLVTDAMPPVGTQSTEFDFFDRIVTCHKGKLTS
STGELAGSTLDMATAVKNCHQLLNVSLSEAVRMASLYPLKFLQKANLPIEPSTLIAINKD
ASFVQLNQELNVVSTWIKGQCVFGSH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacacattgaaatctcctaaccgaatactcactaaagcactttttgatggagccaac
caccattacgacaaagtgctaagtgttttaaagggtgtaattgtggctgtggataatgat
atatcaaaccatgatgttgcccttgatggcctggtagtccctggttatgttgatcttcaa
gtaaatggtgggggcggacttttatttaatgcaaaccccagcatagactcacttaaaaag
atgatgcaagcccattcacagttcggtacgaccgcaatgttaccgacgataattactgac
aacctcaaaaccatgattcgtgcagcagatacaattagtcatgccatcaaagacaatatg
ttggggatcttgggtatacattttgaagggccgcatatctccatcacaaaaaagggagca
catagccaagaatttattcggtctatttcagaggaagagtggaaaatatttgaacgcaaa
gatattggtcatgttttggtaacgttggcgccagaggttttgccaatagaggatatcaaa
aggcttgtatcaatgggtgttcatgtttgtatcggtcacagtaacgcaacttatgagatt
acaaatcgagccatcgaagctggagcaactggatttactcacctctataatgcaatgtct
gcaataacgggaagagaagcgggtgtcactgggagtgctctgttaaatgatcatacgcag
tgtggacttattgtagacggtcatcatgtgagtgttgccagttgtaaacttgcacttaaa
gtaaaacctgtgggaggtatatttctggtcactgacgcaatgccaccagtaggaactcaa
tcaacagaatttgatttcttcgatcgaatagttacatgccataaaggaaaactaacctct
tcaaccggcgaacttgctgggtcaacactcgacatggccacagcggtgaaaaattgtcat
cagctacttaacgtttcactctccgaggcagtccgtatggccagcctataccccctaaag
tttttgcagaaagccaatttgcctatagagccatcaacgcttattgcaattaacaaggat
gcaagttttgtccagttaaaccaagaattgaatgtcgtttcaacttggattaaagggcaa
tgtgtattcggatcgcattaa

DBGET integrated database retrieval system