KEGG   Gibbsiella quercinecans: AWC35_12535Help
Entry
AWC35_12535       CDS       T05060                                 

Definition
(GenBank) xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00040  Pentose and glucuronate interconversions
gqu00053  Ascorbate and aldarate metabolism
gqu01100  Metabolic pathways
gqu01120  Microbial metabolism in diverse environments
Module
gqu_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AWC35_12535
   00053 Ascorbate and aldarate metabolism
    AWC35_12535
Enzymes [BR:gqu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     AWC35_12535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ATA20089
UniProt: A0A250B1M1
Position
2763783..2764655
Genome map
AA seq 290 aa AA seqDB search
MLQKAVSLGIYEKALPQGEDWLARLQLARELGFDFVEMSIDESDERLARLDWSREQRLAL
VDAVLVSGVRVPSMCLSAHRRFPLGSEDDGVRAQGLSIMQKAIQLAQDTGIRLIQLAGYD
VYYQQSNGDTRARFRAGLAQAVEMASRAQVMLAMEIMDYPLMNSISKALGYAHYLNNPWF
QLYPDIGNLSAWDNDVQMELAAGRGHIVAVHVKDTRPGQFKNVPFGDGVVEFDACFETLL
NSGYCGPYLIEMWSETAADPVSEVSAARAWVVAQMRRAGLTIGAGSCWSN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaaaagccgtttcgctcggcatctatgaaaaagccctgccgcagggggaagac
tggctggcgcgcctgcagttggcgcgtgaactggggttcgattttgttgaaatgtcgatc
gacgaaagtgatgaacgcctggctaggctggactggagccgcgaacagcgcctggcgctg
gtggatgccgtattggtttccggcgtccgggtgccttcaatgtgcctgagcgcgcatcgg
cgcttcccgttgggcagcgaagacgacggcgtgcgggcgcaggggctgtcgatcatgcaa
aaggccatccaactggcgcaggataccggtatccggttgatccaactggcgggctacgat
gtttattaccagcagagcaacggggatacccgtgcccggttccgtgccgggttggcgcaa
gcggtggaaatggccagccgcgcgcaggtgatgctggcaatggagatcatggattatccg
ctgatgaattcaatcagcaaggcgttgggctatgcccattatctgaataacccgtggttc
cagctctacccggatattggcaacctgtctgcctgggataacgacgtgcagatggagctg
gcggcggggcgtgggcatatcgtggcggtacacgttaaggatacccggccgggccagttt
aagaacgtgccgtttggtgatggggtggttgagtttgacgcgtgctttgaaacgttgttg
aacagcggttactgcggcccgtatttgattgaaatgtggagtgaaaccgccgccgatcca
gttagtgaggtcagcgcggcgcgcgcctgggtggtggcgcagatgcgccgcgccgggcta
acgataggagcaggatcatgctggagcaattaa

DBGET integrated database retrieval system