KEGG   Gibbsiella quercinecans: AWC35_12775Help
Entry
AWC35_12775       CDS       T05060                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00010  Glycolysis / Gluconeogenesis
gqu00020  Citrate cycle (TCA cycle)
gqu00620  Pyruvate metabolism
gqu01100  Metabolic pathways
gqu01110  Biosynthesis of secondary metabolites
gqu01120  Microbial metabolism in diverse environments
gqu01130  Biosynthesis of antibiotics
gqu01200  Carbon metabolism
Module
gqu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWC35_12775
   00020 Citrate cycle (TCA cycle)
    AWC35_12775
   00620 Pyruvate metabolism
    AWC35_12775
Enzymes [BR:gqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     AWC35_12775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ATA20134
UniProt: A0A250B1U8
Position
complement(2826953..2828572)
Genome map
AA seq 539 aa AA seqDB search
MRAKGITHQDLAVYGIHNAGEIIYNPGYELLFTEETDPSLEGLERGIETKLGAIAVDTGR
FTGRTPKDKYIVRDDTTRDTVWWADQGKGKNDNKPLSQETWTDLKQLVGEQLSGKRLFVV
DAFCGANPDSRLKVRFITEVAWQAHFVKNMFIRPAEEELLDFEPDFVVMNGAKCTNPNWQ
QQGLNSENFIAFNLTERMQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFEGGCYAKTINLSEEAEPDIF
HAIKRDALLENVTVLADGSVDFNDGSKTENTRVSYPIYHIHNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTPDQTQYHFLSGFTAKLAGTEQGVTEPTPTFSACFGAAFLSLHPTRY
AEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKNTRAIIDAILSGEIDEAGTQTLPIFNLT
IPTALPGVNTEILDPRATYASAAQWEEKAKDLAQRFTTNFDKYTDTPAGEALLSAGPKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctaaaggtataacccaccaggatcttgctgtttacgggatccataacgccggc
gagattatctacaatccgggttatgaattgctgtttacggaagaaaccgatccttcgctg
gaagggctggaacgtggcatagaaaccaagctgggcgcaatcgccgttgataccgggcgt
ttcaccggccgaacgcccaaagacaaatacatcgtgcgtgacgataccacccgcgatacc
gtctggtgggccgatcagggcaaaggtaaaaacgacaacaaaccgcttagccaggaaacc
tggacggatctgaaacagctggtaggcgaacagctctccggcaaacgcctgttcgtggtt
gatgcattttgcggcgccaaccctgattcgcgcctgaaagtgcgctttattaccgaagtg
gcctggcaggcgcactttgtgaaaaacatgtttatccgccctgccgaagaagagctgctg
gattttgagccggatttcgtggtgatgaacggcgccaaatgcaccaacccgaactggcag
cagcaggggttgaactccgagaactttatcgcctttaacctgaccgagcgcatgcagctg
atcggcggcacctggtacggcggcgaaatgaaaaaaggcatgttctcgatcatgaactac
ctgctgccgctgaaaggcatcgcctctatgcactgctcggccaacgttggcgaaaagggt
gacgtggcggtgttcttcggcctgtccggcaccggcaaaaccacgctgtcgaccgatccc
aagcgcaagctgattggcgatgacgaacacggctgggacgacgacggcgtgttcaacttt
gaaggcggctgctacgcgaagaccatcaacctgtcggaagaggccgagccggatatcttc
catgccattaaacgcgatgcgctgctggaaaacgtcaccgtgctggccgatggctccgtc
gatttcaacgacggttcaaaaaccgaaaacacccgcgtgtcctacccgatttaccatatc
cacaacatcgtcaagccggtatccaaggcgggccatgccaccaaagtgattttcctgacg
gccgatgccttcggcgtgctgccgccggtttcacgcctgacgccggatcagacccagtac
cacttcctctctgggtttaccgccaagctggccggcacggaacaaggcgttaccgaaccc
acgccaaccttctccgcctgttttggcgccgccttcctgtcgttgcaccccacacgctat
gccgaagtgctggtgaagcgtatgcaggccgccggcgcccaggcttacctggtgaatacc
ggctggaacggaaccggcaaacggatctccatcaagaatacccgcgccattatcgatgcc
attctcagcggcgaaatcgatgaggccggcacccaaacgctgccgatcttcaacctgacc
atcccgaccgcgctaccgggcgtgaacacggagattctggatccgcgcgccacttacgcc
agcgccgcgcaatgggaagaaaaggccaaagacctggcacagcgcttcaccaccaacttt
gacaagtacaccgatacgccagcgggcgaagcgctgctcagcgcagggccgaagctctag

DBGET integrated database retrieval system