KEGG   Gibbsiella quercinecans: AWC35_14075Help
Entry
AWC35_14075       CDS       T05060                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00220  Arginine biosynthesis
gqu01100  Metabolic pathways
gqu01110  Biosynthesis of secondary metabolites
gqu01130  Biosynthesis of antibiotics
gqu01230  Biosynthesis of amino acids
Module
gqu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AWC35_14075
Enzymes [BR:gqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AWC35_14075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ATA20376
UniProt: A0A250B2T2
Position
complement(3092400..3093419)
Genome map
AA seq 339 aa AA seqDB search
MSTMNPFYKRHFLRLMDFTPAEILALLKLAADLKQAKKQGQETRHLQGKNIALIFEKDST
RTRCSFEVAAYDQGAQVTYLGPSGSQIGHKESMKDTARVLGRMYDGIQYRGYGQELVETL
AHYAGVPVWNGLTNEFHPTQLLADLLTVQEHLPGKTLADVKFAYIGDARNNMGNTLMEAA
ALVGMDLRLVAPKACWPEAELVAECQALAQQTGGKITLTDEIAIGVKGVDFLYTDVWVSM
GEPKEAWQERIQQLRPYQVNMAMVQQTGNPAVKFLHCLPAFHDDKTTIGKQMAEQYGLHG
GMEVTDEVFESEHSVVFDQAENRLHTIKAVMVATLSQTL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatgaacccattttataaacgtcatttcttaaggttaatggatttcactccc
gccgagatcctggcgctgcttaagctggcagccgatctgaaacaggcgaaaaaacagggc
caggaaacccgccacctgcagggtaaaaatatcgcgctcatcttcgaaaaagactcaacc
cgcacccgatgctctttcgaagttgccgcatacgatcaaggcgcccaggtgacctacctc
ggcccaagcggcagccagatcggccataaggaatccatgaaagacaccgcgcgcgtgctt
ggccgcatgtacgacggtattcaataccgcggctacggccaggaactggtggaaaccctg
gcgcactatgccggcgtgccggtgtggaacggcctgaccaacgagttccacccgacccaa
ctgctggcggatctgctcaccgtgcaggaacacctgccgggcaaaaccctggcggacgtc
aagttcgcctatatcggcgacgcccgcaataacatgggcaacaccctgatggaagccgcg
gcgctggtggggatggacctgcgcctggtggcgccgaaagcctgctggccggaagccgaa
ctggttgccgagtgccaggcgctggcgcagcagaccggcggcaaaatcaccctgacggat
gagattgccatcggcgtgaaaggcgtggacttcctgtataccgatgtgtgggtatccatg
ggcgaaccgaaagaagcctggcaggagcgcatccagcagttgcggccttatcaggtgaac
atggccatggtgcagcagaccggcaacccggcggtgaaattcctgcactgcctgccggcg
ttccacgacgataaaaccaccattggcaaacagatggcggaacagtacggcctgcacggc
ggcatggaagtcaccgacgaggtgtttgaatccgaacacagcgtggtgttcgatcaggcg
gaaaaccgcctgcacaccatcaaagcggtgatggtcgcgacgctaagccaaacgctgtaa

DBGET integrated database retrieval system