KEGG   Gibbsiella quercinecans: AWC35_17975Help
Entry
AWC35_17975       CDS       T05060                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00072  Synthesis and degradation of ketone bodies
gqu00280  Valine, leucine and isoleucine degradation
gqu00650  Butanoate metabolism
gqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AWC35_17975
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AWC35_17975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWC35_17975
Enzymes [BR:gqu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AWC35_17975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ATA21079
UniProt: A0A250B4H6
Position
3995155..3995799
Genome map
AA seq 214 aa AA seqDB search
MNPRNRIARRAAEYFTDGDVINLGIGIPSLCSDYAPPGVMFHTENGLVGMGPLVDGVLAV
EGFSNATALRFIPVPGASAFDSAESFALVRSGKLAATVLGGLQVAANGDLANWAQPGRVF
GMGGAMDLVSGARKVIVTMELCTKDGKPKVVNACSYPLTGRRCVDHIVTEQCVIDVTPDG
LVLVELLEGLTPDDIQSQVEPRLIVPASPKVMSA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacccacgtaacagaatcgcccgccgcgcggcggagtacttcaccgacggcgacgtt
atcaacctcggcatcggcattcccagcctgtgcagcgactatgccccgcctggggtaatg
ttccacaccgaaaacggcctggtggggatggggccgctggtggacggcgtgttggcggtg
gagggcttttccaacgccaccgccctgcgttttattccggtacccggcgccagtgcgttc
gacagtgcggaatcttttgcgctggtacgttccggcaagttggcggcgacagtgctgggc
gggctgcaagtggcggcaaacggcgatttggccaactgggcccagcccggccgggtgttc
gggatggggggcgcgatggatttggtcagcggcgcccgcaaggtgatcgtcaccatggag
ctgtgcaccaaagacggtaagccgaaggtggtcaacgcctgtagctatccgctgaccggg
cgccgctgcgtggatcatatcgttaccgaacagtgcgtcatcgacgtcacgcccgatggg
ctggtgctggttgaactgctggaagggctgacgccggacgacatccagagccaggtggaa
ccccggctgatcgtacccgcatcgccgaaggtgatgtcggcctga

DBGET integrated database retrieval system