KEGG   Gibbsiella quercinecans: AWC35_22975Help
Entry
AWC35_22975       CDS       T05060                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00520  Amino sugar and nucleotide sugar metabolism
gqu01100  Metabolic pathways
gqu01503  Cationic antimicrobial peptide (CAMP) resistance
Module
gqu_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AWC35_22975
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    AWC35_22975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:gqu01005]
    AWC35_22975
Enzymes [BR:gqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     AWC35_22975
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     AWC35_22975
Lipopolysaccharide biosynthesis proteins [BR:gqu01005]
 Unusual sugar
  AWC35_22975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C NAD_binding_10 3Beta_HSD TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ATA21967
UniProt: A0A250B764
Position
5177369..5179354
Genome map
AA seq 661 aa AA seqDB search
MKTIVFAYHDIGCAGLKALTEAGYDVQAVFTHTDAPGENHFFSSVARLGAELNLPVYAPE
DVNHPLWVERIRELQPDVIFSFYYRNMLSEEILALAPQGGFNLHGSLLPRYRGRAPVNWV
LVNGETETGVTLHKMVKRPDAGDIVAQHKVAISEDDTALTLHGKLREAAQSLLNDTLPQL
KNGSVTFTPQNEAEASYYGRRTAADGEIQWHKSAREINNLVRAVTDPYPGAFSYLGQQKV
IVWQGRVLNTPHDKQPGTVLATAPLTIACGEGALEIVAGQSEAGLYVHGARLAEEMGIVT
DVRLGAKPTSAVKRRTRVLILGVNGFIGNHLTERLLRDGNYDIYGLDISSDAICRFLDDP
HFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIVRDC
VKYHKRIIFPSTSEVYGMCDDQQFDEDCSRLIVGPISKQRWIYSVSKQLLDRVIWAYGVQ
QGLKFTLFRPFNWMGPRLDSLDAARIGSSRAITQLILNLVEGSPIKLVDGGEQKRCFTDI
NDGIEALFRIIENCHGQCDGQIINIGNPTNEASIRELAEMLLECFNQHPLRDRFPPFAGF
NAVESSSYYGKGYQDVEHRTPSIRNAQRLLDWQPTIKMRQTVAETLDYFLQTNVQEKGVS
Q
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactatcgtatttgcttaccatgatatcggctgcgccggtttgaaagcgctaacg
gaggccggctatgacgtgcaggccgtgttcacccataccgatgcgccgggtgaaaaccat
ttcttttcttccgtggcgcggttgggcgcagagctgaatctgccggtttatgcgccggag
gacgtcaatcaccctttgtgggttgaacgtattcgcgagctgcagccggacgtgattttc
tcgttctactaccgcaacatgctcagcgaagagatcctggcgctggcgccgcaggggggc
ttcaacctgcatggatcgctgttgccgcgctaccgcgggcgggcgccggtcaactgggtg
ctggttaacggcgaaaccgaaaccggggtaacgctgcataaaatggttaagcgcccggat
gccggcgacatcgttgcccagcataaggtcgcgattagcgaggatgacacggcgttaacc
ctgcacggtaaactgcgggaagccgcgcagagcctgctgaacgacaccttgccgcaactg
aagaacggcagcgtaaccttcaccccgcaaaacgaggccgaagccagctattacggccgc
cgcactgccgccgatggcgagatccagtggcataaatccgcgcgggaaatcaacaacctg
gtgcgcgcggtaaccgatccttacccgggtgcgttcagttacctgggccagcagaaagta
attgtctggcaggggcgcgtgctgaatacaccgcatgacaaacagccgggcactgtgctg
gccactgcgccgctgaccatcgcctgtggcgaaggcgcgctggaaatcgtcgccggccag
agcgaggcggggctgtatgtgcacggtgcccgcctggcagaggaaatgggcatcgtcacc
gatgtgcgcctgggcgccaagccgaccagcgcggttaaacgccggacccgggtgttgatt
ctgggggtgaacggctttatcggcaaccacctgaccgaacgcctgttgcgcgacggcaac
tacgatatctatgggctggatatcagctccgacgccatttgccgcttccttgacgatccg
cacttccactttgtggaaggggacatcagcatccattccgagtggattgaataccacatt
aaaaaatgcgacgtggtgctgccgctggtggccatcgcaacgcctatcgaatacacccgc
aacccgctgcgtgtgttcgagctggatttcgaagagaacctgaaaatcgtgcgcgactgc
gtgaaataccacaagcgcattattttcccctccacatccgaagtttacggcatgtgcgac
gatcagcagtttgacgaagactgttcgcgcttaatcgtcgggccgatcagcaagcaacgc
tggatctactcggtctccaaacagctgcttgaccgggtgatctgggcttacggcgtgcaa
caggggctgaaatttaccctgttccgtccgttcaactggatggggccacggctcgatagc
ctggatgccgcacgcatcggctcttcccgcgcgattacccagttgatcctcaacctggtg
gaaggatcgccgatcaagctggtggatggcggggagcaaaaacgctgctttaccgacatt
aacgacggcatcgaagcattgtttcgcattatcgaaaactgccacggccagtgcgacggc
cagattatcaatatcggcaacccgaccaacgaagccagcatccgcgaactggcggaaatg
ctgctggaatgcttcaaccagcacccgctgcgcgatcgcttccctccgttcgccggtttt
aacgcggtggaaagcagcagctactatggcaaaggctatcaggacgttgagcaccgcacg
ccgagcatcaggaacgcacagcgcctgctggattggcagccgaccattaaaatgcgccag
acagtagccgaaacgctggattactttctgcaaaccaacgttcaggaaaagggcgttagc
caatga

DBGET integrated database retrieval system