KEGG   Gossypium raimondii: 105761203Help
Entry
105761203         CDS       T04129                                 

Definition
(RefSeq) protein translation factor SUI1 homolog 2-like
  KO
K03113  translation initiation factor 1
Organism
gra  Gossypium raimondii
Pathway
gra03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gra00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105761203
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gra03012]
    105761203
Translation factors [BR:gra03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    105761203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1 Img2
Motif
Other DBs
NCBI-GeneID: 105761203
NCBI-ProteinID: XP_012434405
UniProt: A0A0D2P046
Position
7
AA seq 111 aa AA seqDB search
MSDLDIQIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL
KDLKEFCCNGTVVQDPELGQVIQLQGDQRNNVSTFLVQAGIVKDNIKIHGF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcttgacatccaaattcctactgcctttgatccgtttgctgatgcaaatgct
gaggactctggtgctggtaccaaggagtacgtgcacattcgtatccaacaacggaatggt
aggaaaagcttgactactgtccaagggttgaagaaagaatttagctataacaaaattctc
aaggacctcaaggagttctgttgcaatggcactgttgtccaggaccctgagttagggcag
gttattcaacttcaaggtgatcaaaggaataacgtctccacttttcttgttcaggctggt
attgtgaaggacaacatcaaaatccatggtttttaa

DBGET integrated database retrieval system