KEGG   Gossypium raimondii: 105764460Help
Entry
105764460         CDS       T04129                                 

Definition
(RefSeq) putative ATP-dependent RNA helicase DHX33
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
gra  Gossypium raimondii
Pathway
gra03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gra00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105764460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gra03041]
    105764460
Enzymes [BR:gra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     105764460
Spliceosome [BR:gra03041]
 Complex C
  Other components
   Step II factors
    105764460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 AAA_19 T2SSE DUF2075 PhoH Sigma54_activ_2 ABC_tran AAA_23
Motif
Other DBs
NCBI-GeneID: 105764460
NCBI-ProteinID: XP_012438491
UniProt: A0A0D2RH61
Position
8
AA seq 718 aa AA seqDB search
MPSVVESQQPNGNISFKHNRNNNNKPNFFAGRQKILEHRKSLPIASVERRLVEVVQENDV
LIIVGETGSGKTTQIPQYLFDSGFCHDGKTIGVTQPRRVAAVTVAKRVAEECGVELGQKV
GYSIRFEDVTSSSTRIKYMTDGLLLREALLDPYLSRYSVIVVDEAHERTVHTDVLLGLLK
RVQNVRSNHIKDQTSVGHKRASNGAILEKENADPCIGVLKQCQGRNLSPLKLIIMSASLD
AHVFSKYFGGAKAVRVLGRQFPVDLFYSVDPQTDYLDSAIVTIFQIHSEEAPGDILVFLT
GQEEIESVEKQIHENLQRLPEDKRKMKTVTIFSSLPSEQQMQVFAPAPAGFRKVILATNI
AETSVTIPGIKYVVDPGVVKARSYDPVKGMESLIIVPTSKAQAIQRSGRAGREGPGKCFR
LYPESEFEKLEDSTKPEIKRCNLSNVILQLKALGVDDIFGFDFIEKPSRTAIKKSLEELL
LLGALTDEFKLSDPVGRQMARLPLDPVHSKALILASQFKCLDEMLIAVAMLSVESIFYEP
REKLDEARTAKKCFASSEGDHLTLINVYRTSIELLEKRKSEVGKDKAEKVMRKWCKENFI
NSRSLRHARDIHSQIRRLVEQIGLRISSCGDDTLQFRRCLAAAFFLNAALKQPDGTYRAL
ASGEVVQIHPTSVLFRTKADCIIFNEFVKTTNKYIRNITIIDGLWLTELAPHYYAKQE
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagtggtggaatcccaacaacccaacggcaacatctcttttaagcacaaccga
aataataacaacaaacccaatttctttgccgggagacaaaagattttagagcatcggaag
tcgcttcctattgcttcagttgagagaagacttgttgaggtggttcaagaaaatgatgtc
ttaatcattgttggagaaactggaagtgggaaaacaacccagatacctcagtatttattt
gattctgggttctgccatgatgggaaaactattggggtaacgcagccgaggcgtgttgct
gcggtcacagttgcaaaaagggtagccgaagaatgtggtgttgagttgggacaaaaagtt
gggtattcaattaggtttgaggatgtcacctcaagctcaacgaggatcaagtacatgact
gatggattacttcttagggaggcattattggatccgtatctctctaggtattcagtgata
gttgttgatgaagctcatgaaagaactgtccacacggatgtattgttgggtttgcttaaa
agggtacaaaatgtgaggtccaaccatataaaagatcaaactagtgttggtcataagagg
gcaagcaatggtgcaatcttggagaaagaaaatgctgatccctgcattggtgttttaaag
caatgccaggggaggaatttgtcacctttgaaattaatcatcatgtctgccagcttggat
gcacatgttttctctaaatactttggtggtgcaaaagctgttcgtgttctaggacgacaa
tttccagttgatttattctattctgtcgatccccagactgattatctagattctgctatt
gtcaccatcttccagattcactcggaggaggctcctggtgacattcttgtgtttttgact
gggcaagaagagattgaatcggttgaaaaacaaatccatgagaatttacaacggttacct
gaagataagcggaagatgaaaacagttactatattctcatccctcccttcagaacaacaa
atgcaagtttttgcacctgctcctgcaggatttcgtaaggttatactagcaactaatatt
gctgagacatccgtgacgatacctggaattaagtatgtcgtagatcctggagttgtaaaa
gcacgttcttatgatccagtcaaggggatggaatcattgattattgttccaacctcaaaa
gcacaagcaatacagagaagtggacgtgcagggcgtgaaggacctgggaagtgtttccgt
ctctatcctgagagcgagtttgaaaagcttgaggattcaaccaagccagagattaagcgt
tgcaacctctcgaatgtcattttgcagctcaaggccctgggtgtcgatgatatatttggg
tttgacttcatagagaaaccctcaaggacagctattaaaaagtcattggaggagttgctc
ttgctaggtgctttaactgatgaattcaaactgtcagatccagttggtcgtcaaatggct
cggctcccattagatcctgttcattctaaagctctcatcctagctagccagttcaagtgc
ctggatgaaatgttaattgctgttgcaatgctttcagtagaatctattttttatgagcca
cgtgagaagttggatgaggcaagaactgcaaagaaatgctttgcaagttccgagggagac
catctcactttgattaatgtttatcgaacgtctattgagttattggagaagagaaagtcc
gaggttggcaaagataaggctgaaaaagttatgagaaagtggtgcaaggaaaactttatc
aatagccgttctttgcggcatgctcgtgacatccacagtcaaatccgccgacttgttgaa
caaataggccttcgcatttcttcttgtggagacgacacacttcagttccgcagatgcctt
gctgctgcttttttcctcaatgcagctttgaagcaacctgatggaacatacagggctttg
gcaagtggtgaggtggtacagatccatccaacatctgtgttattccgaacaaaagcggac
tgcattattttcaacgagtttgtcaaaactactaataagtacatccgcaatataactata
atcgatggcctttggttgacagagttagccccccactattacgccaagcaggagtag

DBGET integrated database retrieval system