KEGG   Gossypium raimondii: 105764513Help
Entry
105764513         CDS       T04129                                 

Definition
(RefSeq) probable apyrase 6
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
gra  Gossypium raimondii
Pathway
gra00230  Purine metabolism
gra00240  Pyrimidine metabolism
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105764513
   00240 Pyrimidine metabolism
    105764513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gra04090]
    105764513
Enzymes [BR:gra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     105764513
CD molecules [BR:gra04090]
 Proteins
  105764513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 105764513
NCBI-ProteinID: XP_012438563
UniProt: A0A0D2RHC2
Position
8
AA seq 545 aa AA seqDB search
MRRLNARHRVDSELKTTTNQPKMDPIKFQTRPNSRSTALFSRNLRQTKPTPSLFAISVSV
SLAVLIFSSIFIFSSPVSTKYGIIIDGGSTGTRIHVFRYRVDGSKNLVFDFKEGSDSLKV
NPGLSAYVEYPEAVSDSLGKLLEFGRKKVPRKQLAETEIRLMATAGLRLLDVELQERILE
ECRKVLRVSGFKFHDEWASVITGSDEGVYAWVVANYALGTLGGNPLDTTGIIELGGASAQ
VTFFSSEPMPSKFSRSIKFRNFTYSLYSHSFLHFGQDVAHESLRESLIKGDFSPASGSLN
KEMYVDPCTPKGYLAPSSNLSLGYTAEKSKYSSELQATGNFSECRSAALMLLQNGKEKCS
NYRCYLGSVFMPKLQGKFLATENFFHTSKFFRLHQRASLSDLMMAGQHFCGEDWSKLKKK
HQSLGEEELLRYCFSSAYIVALLHDSLGIALDDERISFANLVENIPLDWALGAFILQNMA
KLDAQQIDWITTIISNDSPTLFSIIAVSAILMFIAWFILKWRKPELKTVYDLEKGRYIVT
RIGRK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgattgaatgctcgacatcgggtcgattccgaactcaagaccaccaccaaccaa
cctaaaatggatccaattaagttccaaacccgacccaattcccgatccaccgctcttttt
tcgcgaaaccttcgtcaaaccaagcctaccccttctctctttgcaatctcagtatccgta
tctctcgctgtattgatttttagttccattttcattttctcctcaccagtgtccacgaag
tatggaatcataatcgatggtggaagcacgggaacgaggatccacgtgtttcggtacaga
gttgatggaagcaaaaacctggttttcgattttaaagaagggtcagatagcttgaaggtt
aatccggggttgtcggcttacgtggagtatccggaagctgtttcggattctttgggaaag
cttctggagtttgggaggaagaaagttccaagaaaacagttggcagagacggaaattagg
ttaatggcgacggctgggctgaggttgttggatgttgagttgcaggagcggattttggag
gagtgcaggaaggtgcttagggtgtctgggtttaagtttcacgacgagtgggcgtcagtt
attacaggctctgatgagggggtctatgcttgggttgttgcaaactatgcacttggtact
cttggaggtaatcctctggatacaactggaattattgaacttggtggggcatctgctcag
gtaacctttttctcaagtgagcctatgccttctaagttctcacgctccatcaagtttagg
aatttcacttacagtctctatagtcacagctttcttcattttggccaggatgttgcacat
gaatcattgagggaatccttaattaaaggagatttcagtcctgcttctggctctcttaat
aaggagatgtacgtagatccttgtacacctaaaggttacttggctccatcatcaaatctt
tcactgggttatacggctgaaaaaagtaaatatagttccgaacttcaagctactggtaac
ttctcagagtgcagatctgctgcattaatgctattacaaaacggaaaagaaaaatgttcc
aactaccgctgttatttggggtctgttttcatgcccaagcttcaaggaaaatttttggct
acagaaaatttcttccatacctcaaagttctttaggttgcatcaaagggcctctctttct
gatctcatgatggcggggcaacatttctgtggagaagattggtcaaaattgaagaagaag
caccaatcacttggtgaggaagaactgttgcgctattgtttttcttcagcatatattgtg
gccttacttcatgatagccttggaattgctttggatgatgaaaggatcagctttgctaat
ctggtagaaaatataccactagattgggccttgggagctttcatattacaaaacatggcc
aagttggatgcgcagcaaattgattggataactaccattatcagcaatgattcacccacg
ctattctccatcattgccgtttctgcaatattgatgttcatagcttggtttatattgaaa
tggaggaaacccgagttgaagacagtgtatgatttagagaaaggacgatatatagtgact
cgtattggcagaaaatga

DBGET integrated database retrieval system