KEGG   Gossypium raimondii: 105764901Help
Entry
105764901         CDS       T04129                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
gra  Gossypium raimondii
Pathway
gra00052  Galactose metabolism
gra00500  Starch and sucrose metabolism
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105764901
   00500 Starch and sucrose metabolism
    105764901
Enzymes [BR:gra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105764901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 105764901
NCBI-ProteinID: XP_012439149
UniProt: A0A0D2PZB7
Position
8
AA seq 648 aa AA seqDB search
MPKMEASSSTSHDPALFHAPLLHHPRRRSSRPLKGFAVIIGSVVFLLSLVILIVNQSPEP
LASNPSSVTEAGSYSMAAQPRGIAEGVSAKSNPSLFDKVGFNWTNAMFYWQRTAYHFQPQ
KNWMNDPDGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWFYLPLAMVPDQWYD
INGCWTGSATLLPDGRIVMLYTGSTNDSVQVQNLAYPANLSDPLLLQWLKYPGNPVVVPP
TGIEDEEFRDPTTAWLGPDGSWRIAVGTRFNTTIGTALVFQTTNFSDYELLDGVLHAVPG
TGMWECVDFYPVAINGSVGLDTTALGPGIKHVLKASLDDTKVDHYAIGTYDMITDKWTPD
NPEEDVGIGLKVDYGRYYASKTFFDQSKQRRILYGWVNETDSEADDLEKGWASIQTIPRS
VLYDNKTGTHLLQWPVEEVESLRLNATVFKDVVVEAGSVVPLDIGTATQLDILAEFEIET
LVLNSTEDEVSDCGDGAVDRSTYGPFGVLVIADDSLSELTPIYFRPLNTSDGSLETYFCA
DETRSSKAPDVTKRVYGGKIPVLDDENYNMRVLVDHSVVESFGEGGRTVITSRVYPTEAI
YGAARLFLFNNASGVNVKATLKIWEMNSAFIRPFPFEETLFQEMVAST
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatggaggccagcagcagcacctcccatgacccggcattgttccatgctccc
ttgctacaccaccctcggagaaggagcagcagacccttaaagggtttcgcagtgataatt
gggtccgtcgttttcctactctcactggtcatattaatcgttaaccaaagcccggagcca
ttagcaagtaaccccagtagtgtaacggaggcagggtcgtattcaatggcggcgcagcca
agagggatagctgaaggtgtttcagccaagtcaaacccatcactttttgacaaagttggg
tttaattggacaaacgctatgttttactggcaaagaactgcctaccactttcagcctcaa
aagaattggatgaatgatcctgacggtccgttatatcacaagggatggtaccatcttttc
tatcaatacaaccccgattcagccatatggggcaacatcacttggggccacgctgtatca
aaggacctcattcactggttctatcttccactcgccatggtccctgatcaatggtacgat
atcaacggttgttggacggggtcggccactctcctgccagatggccgaatcgtaatgctt
tacaccggcagcaccaatgactccgtgcaagtccaaaaccttgcatatcccgccaaccta
tctgatcccctcctccttcagtggttaaaatacccgggtaacccggttgttgttccccca
accgggatcgaagacgaagagttccgagacccgacaacagcttggcttggacccgatggt
tcctggcggattgctgttggtacaaggtttaataccaccataggaacagcccttgttttt
caaacgacaaacttttctgactatgaattattggatggggtcttacatgctgttccgggt
acgggtatgtgggaatgtgtagatttttaccccgttgcaataaacgggtcggtcggactg
gacacgacggcacttgggcctggaattaagcatgtcctgaaggctagtttggatgatacg
aaagttgatcattatgcaatagggacctacgacatgataacggataaatggacacctgat
aacccggaagaagatgtaggcatcgggttgaaagtggattatgggagatactatgcctcc
aagacattttttgatcagagtaaacaaaggaggattctttatggttgggttaatgaaact
gattctgaagctgatgacctcgaaaaaggatgggcttccattcagacaattcccaggagt
gtgttgtatgacaacaagaccggaacccatttactacagtggcctgtggaagaagtggag
agcttgagactgaatgctacagtgtttaaggatgttgtagttgaagcaggatcagttgtg
cccctcgacataggcaccgctactcagttggatatattagcagagtttgaaatagagacg
ttggtattgaacagcacggaggatgaagtcagtgattgcggtgatggggcggttgatagg
agcacttacgggccatttggggtcctggttattgctgatgattcactttctgagctcact
cctatatatttccgtccacttaatacatccgatgggagtcttgaaacttacttttgcgct
gacgaaacaaggtcttctaaagctcccgatgtcacgaaacgagtgtatggaggcaaaatt
ccagtccttgacgatgaaaactacaatatgagggtattggtggatcattcagtagtggaa
agttttggagaaggagggaggacggtgataacatcaagagtgtatccaacggaagccata
tatggagcagcacggctgttcttgttcaacaatgcaagtggagtgaatgtgaaggccaca
ctcaaaatatgggagatgaattctgcctttattcgtcctttcccatttgaagaaacatta
tttcaggaaatggttgcttccacatga

DBGET integrated database retrieval system