KEGG   Gossypium raimondii: 105764938Help
Entry
105764938         CDS       T04129                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
gra  Gossypium raimondii
Pathway
gra00906  Carotenoid biosynthesis
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Module
gra_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    105764938
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     105764938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 105764938
NCBI-ProteinID: XP_012439211
UniProt: A0A0D2RK31
Position
8
AA seq 605 aa AA seqDB search
MDAFSSSFLSTLTPSTKLLSPVITTTLRSTSPSPYYAPLPYISSVRIEEKPPTSTTTTKT
SHPPPPQSPKAWPPPAPSYASPSVGAKKRVEPRLSTMIFNTFDDIINNFIDPPLRPSVDP
KHVLSHNFAPVDELPPTPCEVIQGSLPPCLDGAYIRNGPNPQFLPRGPYHLFDGDGMLHS
IRISKGKATLCSRYVKTYKYSIENQMGSPVFPNVFSGFNGLTAAATRGALSAVRILSGEF
NPANGIGLANTSLALFGNRLYALGESDLPYSIRLTSKGDIQTLGRIDFDGKLFMSMTAHP
KIDDDTGEAFAFRYGPVPPYLTYFHFDANGNKQPDVPIFSMTRPSFLHDFAITKKYAIFA
DIQIGMNPMDMIIGGGSPVGTDPAKVPRIGIIPRYAKDESEIRWFDVPGFNLIHAINAWD
EDDGNAIVLLAPNILSVEHTLERMDLVHALVEKVRIDLRTGLVTRHPISARNLDFAVLNP
AYVAKKNKYVYAAVGDPMPKIAGVVKLDVSKGERQECTVGSRMYGPGCFGGEPFFVAKEP
QNPEADEDDGYVVSYVHNENTGESRFLVMDAQSPNLDIVAAVKLPRRVPYGFHGLFVRES
DLNKL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggatgccttttcttcctcctttctctccaccctaacaccttcaacaaaactcctttct
cccgttatcaccaccactctcagatcaacttccccatcaccttattatgctcctctcccc
tacatttcctctgtcagaattgaagagaaacctcctacctccacaaccaccaccaaaaca
tcacatccaccaccaccccaatctcctaaagcttggcctccaccagcgccatcctatgct
tctccatcagttggagccaagaaaagagtagaaccaaggctgtccaccatgatcttcaat
acatttgacgatattataaacaacttcatagaccctccactcaggccttctgtcgacccc
aagcatgtcctgtcccacaacttcgctcctgttgatgagcttcctcctacaccctgtgaa
gttatacaaggatccctcccgccttgccttgacggtgcatacattcgtaatggccccaac
cctcagttcctccctcgtggaccttaccacctcttcgatggtgatggtatgcttcactcc
attcgaatctccaagggcaaggccaccttgtgtagcagatacgtaaagacgtacaagtac
tccattgaaaaccaaatgggttctcccgttttccccaatgttttctccggctttaacggc
ctaaccgccgcggccactcgcggtgctctctccgctgtcagaattctatccggtgagttc
aatcctgcaaacggtattggtcttgcaaacactagtttggccttgtttgggaaccgtctc
tacgcgcttggtgagtcagatctaccttactctatacgcttaacatccaaaggggatata
caaacattgggtcgcattgattttgatggaaagttgttcatgagcatgactgctcaccct
aagatagacgatgacaccggcgaggcctttgctttccgatatgggcctgtgcctccatat
ctaacttattttcactttgatgctaatggaaataagcaaccagatgtccctatattctct
atgacccgcccatcttttcttcatgacttcgcaattacaaagaagtacgctatatttgcg
gacatacaaatagggatgaaccccatggacatgatcattggaggtggatctccggtggga
acggacccagctaaggtacctagaatcggaatcatccctcgatatgcaaaagacgagtcg
gaaatcaggtggtttgatgtgcctggtttcaacctcatacatgccatcaatgcatgggat
gaagatgatggcaacgccatagtcttgctggcacccaacattctatcagtagagcacacc
ctggagagaatggacctggttcatgctttagtggagaaggttagaatcgacttaagaaca
gggctggtaacaaggcaccccatttcagcaagaaatctggatttcgcagtactaaatcca
gcttatgttgcaaagaagaacaaatatgtgtacgcggcggttggggacccaatgccaaaa
atagcaggagtggtgaaactggatgtgtctaagggagagcggcaggagtgcacggtgggt
agtagaatgtatgggccgggctgctttggtggggagccattctttgttgccaaggagcca
caaaatcctgaggcagacgaggatgatggatatgtggtttcgtatgtccacaatgaaaac
acaggagagtcaaggttcctggtgatggacgcacaatcacccaatcttgacatagtggca
gccgtgaagctgccccgtagggttccctacggttttcatggactatttgtgagggaaagt
gatctaaataagctgtag

DBGET integrated database retrieval system