KEGG   Gossypium raimondii: 105765210Help
Entry
105765210         CDS       T04129                                 

Definition
(RefSeq) cysteine--tRNA ligase, cytoplasmic-like
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
gra  Gossypium raimondii
Pathway
gra00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gra00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105765210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gra01007]
    105765210
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gra03016]
    105765210
Enzymes [BR:gra01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     105765210
Amino acid related enzymes [BR:gra01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   105765210
Transfer RNA biogenesis [BR:gra03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    105765210
 Prokaryotic Type
    105765210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f RE_AlwI Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 105765210
NCBI-ProteinID: XP_012439637
UniProt: A0A0D2U944
Position
8
AA seq 546 aa AA seqDB search
MDPSKQETNQKKASKPMARKETQEFQFVVYNTMTQQKEVFNPKIPGKVRMYVCGVTAYDF
SHLGHARAAVSFDVLYRYLKHLGYEVTYVRNFTDVDDKIIRRANETGEDPISLSDRYCKE
YNIDMSDLQCLSPTHEPRVSDHMEQIKDMITQIINKDFGYVVEGDVFFTVDKFSNYGKLS
GQKLENNRAGERVAVDSRKRNPSDFALWKAAKPGEPSWDSPWGPGRPGWHIECSAMSAHY
LSFKFDIHGGGLDLIFPHHENEIAQSCAACKESDVSYWMHNGHVTNNNEKMSKSLGNFFT
IRQITERYHPLALRYFLINAHYRSPLNYSVVQLEGASDAVFYIYQTLKDCQDALLQLQEE
MPNDGKPARISPDAKECISKLRNEFQVKMSDDLSTSLILTGAFLEALKLVNNLLTMLKKK
QQKQQRLLVIQSLKEIQNEVTKVLDVLGLQPPFSYNEVLLQLKEKALTRAGLVEDDVIRL
IKERAEVRRNKDFLKSDQMRAHLQAQGIALMDVGTETIWRPCVPVQQDSEIVPSEGQKVP
PKPESA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggatccctcaaagcaagaaacaaaccaaaaaaaagcttctaaaccgatggctaggaag
gaaacccaagaattccaatttgttgtttacaataccatgactcagcaaaaagaggttttc
aatcccaaaatccctggaaaagttcgcatgtatgtctgcggtgtcactgcctatgatttc
agtcaccttggccatgctcgtgctgccgtttcctttgatgtcctttacaggtaccttaag
catttgggttatgaggttacttatgtcaggaattttactgatgttgatgataagataatt
cgtcgagccaatgagactggagaggatccaataagtttgagtgaccggtactgtaaagaa
tataatatagatatgagtgatctacagtgcctttctccaacacatgagccacgtgtttct
gatcacatggagcagatcaaagatatgataactcagattataaacaaagactttggatat
gttgttgaaggcgatgtgttttttactgttgataaattctcaaattatggcaagttatct
gggcagaagctggaaaacaatagagcaggtgaacgtgttgctgttgactcaaggaagcgt
aatccttccgactttgcattatggaaggctgcaaagccaggtgagccatcttgggacagc
ccttggggacctggacgacctgggtggcacatagaatgtagtgcaatgagtgcacattat
ttaagcttcaaatttgacattcatggtggtgggcttgatttgatttttcctcaccatgaa
aatgaaattgctcaaagttgtgctgcatgcaaagagagtgacgtaagttattggatgcac
aatgggcatgttactaataacaatgagaagatgtcaaaatctttgggtaactttttcaca
attcgccagattactgagagatatcatccactggctttgcgatacttcttgataaatgca
cactatcgttctcctctcaattactctgttgttcagttggaaggtgcatcagacgctgtt
ttttacatatatcagactttgaaagattgtcaagatgctctattgcaactacaagaagaa
atgcccaacgatggcaaaccagctcggattagtccggacgccaaggaatgcattagcaag
ctccgcaatgagttccaggtgaaaatgtcagatgacttgagcacttcacttatactgact
ggagcctttctagaagcattgaagttggtaaacaatttgttgaccatgctaaagaagaag
cagcaaaagcaacaaagattattggtaattcaatcccttaaagagattcagaacgaagtt
acaaaagttttggatgttctgggattgcagccacctttctcttataacgaggttttgctg
caattaaaggagaaagcattaacgagagcggggttggtggaagatgatgtgattcgtcta
attaaagagcgagctgaggtgaggagaaacaaagacttcttgaaaagtgatcagatgaga
gctcatttgcaagcacagggcattgcactcatggatgtaggcacggaaacaatttggaga
ccttgtgttcctgttcaacaagactcggaaatagtgccatcagagggccagaaggtccct
cccaagcctgaaagtgcataa

DBGET integrated database retrieval system