KEGG   Gossypium raimondii: 105765736Help
Entry
105765736         CDS       T04129                                 

Definition
(RefSeq) uncharacterized LOC105765736
  KO
K06195  ApaG protein
Organism
gra  Gossypium raimondii
Brite
KEGG Orthology (KO) [BR:gra00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    105765736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-GeneID: 105765736
NCBI-ProteinID: XP_012440432
UniProt: A0A0D2RPR9
Position
8
AA seq 297 aa AA seqDB search
MHSLSLKVFTDLNSAGTRRSCFPAQVGRGLVVDQRRRVGSGCWDHGGGAAGRKCWVVSCA
VDGGNGGGGERPSLDPNPTQNQSSFLSRSQTYAMLKQQMEVAAKSEDYKEAARIRDSLKI
FEEEEPVLRFRRLIKEAVADERFEDAARYRDELKEIAPHSLLKCSSDATTLGIRVQVRSV
YIEGRSLPSRGQYFFAYRIRITNNSDRPVQLLRRHWIITDGNGKTENVWGIGVIGEQPVI
LPRTGFEYSSACPLSTPSGRMEGDFEMKHIDRVGSPSFNVAIAPFSLSTLGDDADIF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgctcagccttaaggtttttactgatttgaattccgcggggacgaggaggagc
tgttttccggctcaggtgggtcgtggattggtggttgatcaaaggagaagggttggatcg
ggttgttgggatcacggcggcggtgctgctggtcggaagtgttgggtagtgagttgtgcg
gtggatggcgggaacggtggtggcggtgagaggccgagtttggacccgaatccgactcag
aatcagagttcttttttatctcgtagccaaacttatgcgatgctgaaacagcaaatggag
gttgctgctaaatcagaggattacaaagaagcagctagaatacgtgattctttgaaaata
ttcgaggaagaggaacctgttttgagatttaggaggttgatcaaagaggctgttgctgat
gaaagatttgaggatgctgctagatatcgtgatgagttgaaggaaattgcacctcactct
ctcctgaaatgttcaagtgatgcaacaaccttgggaatcagagttcaagttaggagtgtg
tatatagaggggcgtagtctgccctcaagaggccagtactttttcgcatacagaataaga
ataaccaataactcagatcgtccagttcagcttctcagaaggcactggattatcacagat
ggcaatgggaaaactgaaaatgtttgggggattggagttataggcgaacagccagttatt
cttcccagaacaggcttcgaatactcatcggcttgcccattaagcactcccagcggcaga
atggaaggagacttcgagatgaaacacatcgacagagtaggctcaccaagtttcaatgta
gcaattgccccattttcactctccacgctaggggatgatgccgatatcttctga

DBGET integrated database retrieval system