KEGG   Gossypium raimondii: 105766191Help
Entry
105766191         CDS       T04129                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1 isozyme 4-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gra  Gossypium raimondii
Pathway
gra03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:gra00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    105766191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gra01009]
    105766191
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gra03021]
    105766191
   03019 Messenger RNA biogenesis [BR:gra03019]
    105766191
   03041 Spliceosome [BR:gra03041]
    105766191
Enzymes [BR:gra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105766191
Protein phosphatases and associated proteins [BR:gra01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     105766191
Transcription machinery [BR:gra03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     105766191
Messenger RNA biogenesis [BR:gra03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     105766191
Spliceosome [BR:gra03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    105766191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STPPase_N Metallophos
Motif
Other DBs
NCBI-GeneID: 105766191
NCBI-ProteinID: XP_012441008
UniProt: A0A0D2UD66
Position
9
AA seq 96 aa AA seqDB search
MAAATAQGMDPAVLDNIIRWPTEVRSAKPVKQVQLSESEIKQLCVASKDIFVQQPNLLEL
EAPIKICGDIHGQYSDLLRLFEYGGFPPHANYFLVQ
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgacggcgcaagggatggacccagcggtactagacaatataatcagatgg
ccgacggaagtccggtcagccaagccagtgaaacaagtgcaattatctgaatctgagatc
aaacagctttgtgttgcttcgaaagatatcttcgttcaacaacctaatttacttgaactc
gaagcacccatcaaaatttgcggtgacatacatgggcaatatagtgacttactaaggctg
ttcgagtatgggggttttcctcctcatgctaattattttctggttcagtag

DBGET integrated database retrieval system