KEGG   Gossypium raimondii: 105768396Help
Entry
105768396         CDS       T04129                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
gra  Gossypium raimondii
Pathway
gra00051  Fructose and mannose metabolism
gra00520  Amino sugar and nucleotide sugar metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Module
gra_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105768396
   00520 Amino sugar and nucleotide sugar metabolism
    105768396
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     105768396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 105768396
NCBI-ProteinID: XP_012443756
Position
1
AA seq 412 aa AA seqDB search
MEKVVAVIMVGGPTKGTRFRPLSFNTPKPLFPLAGQPMVHHPISACKRIPNLAQIFLIGF
YEEKEFTLYVSSISNELKIPVRYLKEDKPHGSAGGLYYFRNIIMEDNPSHIFLLNCDVCC
SFPLTDMLEAHKRYSGMGTVLVIKVSAESANQFGELVADPITKELLHYTEKPETFVSDLI
NCGVYVFTPDIFTAIQEVSTHREDQANLRHLSSFETLQSPTSRALPQDFVRLDQDILSPF
AGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRYTSPDLLAGGDGTKSASILGDVYV
HPSAKVHPTAKIGPNVSISANVRIGAGVRLIGCIILDDVEVQENAVVINSIVGWKSSIGK
WSRVQADGDYNAKLGITILGEAVIVEDEVVVISSIVLPNKTLNVSVQDEIIL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtggttgctgtgatcatggttggtggacccaccaaagggactagatttaga
cctctttcattcaatactcccaaacccttattccctttagcaggtcagccgatggttcat
cacccaatttctgcttgtaaacggataccgaatttggctcaaatttttctaattggattt
tacgaggaaaaagagttcacattatatgtctcttcgatctcgaacgagctgaaaatacca
gtgagatacttgaaagaggataaaccccatggttcagctggtggcctctattacttcaga
aatattataatggaagacaatccgtcacatatcttcctgctaaactgtgatgtttgttgc
agttttccgttgacagacatgctcgaggctcacaaaagatacagtgggatgggaactgtg
ttagtaatcaaggtatctgctgagtccgctaatcagtttggtgagttggttgctgacccg
atcacaaaagagctattgcactacaccgagaagcccgagacttttgtaagcgatttaatt
aactgtggagtttacgtctttactcctgatatctttactgccattcaagaagtctccaca
caccgagaagaccaagctaatttacgccatttgtcaagctttgaaacgctgcagtctcca
acaagtagggctcttccccaagattttgttagattggatcaagatatcttgtcccctttt
gctggaaagaagcaattatatacgtacgaaactatggatttctgggaacagatcaagact
ccagggatgtctttaaaatgttctggtctttatcttgctcaattccggtatacctcccct
gatctattagctggtggagatggaactaaaagtgcttcgattcttggtgatgtctatgtg
catccctcggccaaagtacacccgaccgcaaagatcggtcccaatgtctctatttcggca
aatgttcgtataggagctggggtgagacttataggttgcatcatcttggatgatgttgaa
gttcaggaaaacgcggttgttattaattctattgttggatggaagtcgtctataggaaag
tggtctcgtgtccaggctgatggagactacaacgcaaagctcggaattactatccttgga
gaggctgtaatagtagaagatgaagttgttgtgatcagtagtattgttcttccgaataag
acccttaatgtgagcgtgcaagacgagatcattttatga

DBGET integrated database retrieval system