KEGG   Gossypium raimondii: 105768847Help
Entry
105768847         CDS       T04129                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
gra  Gossypium raimondii
Pathway
gra00600  Sphingolipid metabolism
gra01100  Metabolic pathways
Module
gra_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105768847
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     105768847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 105768847
NCBI-ProteinID: XP_012444518
Position
9
AA seq 493 aa AA seqDB search
MDQRSDSENLSPFISDLVLVNGKVVPLTFTRDGKLLWNHNDRRCLNVEKEALGFTFEGSR
IRVNVVVEKRDRILCFANMGGIGRQSFVFEPLSEESLTLWSQKLRDYIDSLGRPKRLLIF
VNPFGGKKCATKIFVEDVRPCLEDADIQFTVIETKHQLHAKEVVKTLDLSKYDGIVCVSG
DGILVEVINGLLEREDWSDAIKMPIGMVPAGTGNGMVKSLLDSAGEICSPSNAILAVIRV
LLTGHTRSLDVATISQGKTRFFSVLMLAWGLIADIDIESEKYRWMGSARIDFYALQRITY
LRHYNGRVSFVPAPGFEEYGEQTSYSGEPSCETSTSQQESLNIQQPGYLGSDVKLENMHW
RTISGPFVSIWLHNVPWGSEDVLAAPNAMFSDGYLDLIIVKDIPKLSLLSLLSKMNDGSH
VHCPHVMYLKVKAFVLEPGARIDDPMKEGIIDSDGELLARGNVTYKGNVKCYMAYDKLQI
TVDQGLATLFAPV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacgtagtgattcagagaacctctcacccttcatatcagacctagtcctcgtc
aacgggaaagtggttcccctgacgttcaccagagacgggaagcttttgtggaaccataac
gaccggcggtgcttgaacgttgagaaggaggctctcggattcaccttcgaaggttctaga
atccgagtcaatgtcgtcgtcgaaaagagagatagaatcctctgtttcgcgaacatggga
ggtatagggaggcagagtttcgtgttcgagcctctctctgaggaatcgctcactctctgg
tctcagaagcttcgtgattatattgattctctcggtaggccaaagagactattgatattt
gtgaacccgtttggagggaagaaatgtgcaactaaaattttcgtagaagatgtaagacct
tgccttgaagatgctgatatacagtttactgtcatagaaactaaacatcagctgcatgct
aaagaagttgtcaaaaccttggatttatcaaaatatgatggaattgtttgtgttagtggc
gatggaatccttgttgaggtgataaatggattacttgaaagagaagattggagtgatgca
ataaagatgcctataggaatggttcctgctggaacgggaaatggcatggtgaagtctttg
ctggattcagctggtgaaatatgtagcccatctaatgccattcttgctgttatcagagta
ctcctgacagggcatacacgttcgttggatgtagctactatctcgcaagggaaaacaaga
ttttttagtgtcttgatgcttgcatggggtctgatagcagacattgacatcgaatctgaa
aagtatagatggatggggagtgctcgtattgatttctatgctcttcaacgtataacatat
ttaaggcattacaatggacgtgtttcttttgtgcctgctcctggctttgaagagtatggc
gagcaaaccagttattctggtgaaccttcctgtgaaacaagcacaagtcaacaagagtcc
cttaacattcaacagcctgggtaccttggatccgatgttaagttggagaacatgcattgg
aggactattagcggaccatttgtttcaatctggcttcataatgtaccgtggggaagtgaa
gatgtcctggctgcacccaatgcaatgttctcggacggttatttggacttgattatcgta
aaggacatcccgaaattatccttgctgtcattactatcaaaaatgaatgatgggagtcat
gtacattgtccacacgttatgtaccttaaggtgaaggcatttgtgttggagcctggtgct
cgaatcgatgatccaatgaaggaagggatcatcgactcagatggtgagctacttgccagg
ggaaatgtaacatacaagggtaatgtaaagtgctatatggcgtacgataagcttcaaata
accgtggatcaaggtttagctactttgtttgcacctgtatag

DBGET integrated database retrieval system