KEGG   Gossypium raimondii: 105769390Help
Entry
105769390         CDS       T04129                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 3-like
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
gra  Gossypium raimondii
Pathway
gra00562  Inositol phosphate metabolism
gra01100  Metabolic pathways
gra04070  Phosphatidylinositol signaling system
Module
gra_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105769390
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105769390
Enzymes [BR:gra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     105769390
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     105769390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N Kazal_3
Motif
Other DBs
NCBI-GeneID: 105769390
NCBI-ProteinID: XP_012445446
UniProt: A0A0D2US16
Position
9
AA seq 348 aa AA seqDB search
MRLEEEFSHCDNYDEEEEPKTMSQCSIGALQQQQQQQKFVVVGYALTSKKIKSFLQPKFE
GLARNKGILFVAIDQNRPLSDQGPFDIVLHKLTGKEWRQILEDYRQTHPEVTVLDPPDAI
QHLHNRQSMLQCVADMNLSTSYGRVGVPRQLVIKKDASSIADAVDKAGLILPLVAKPLVA
DGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHGGVLFKVYIVGEAIKVVRRFSLPDVTK
RELSKVTGVFRFPRVSCAAASADDADLDPSVAELPPRPLLERLAKELRWRLGLRLFNLDI
IREHGTRDHFYVIDINYFPGYGKMPGYEHIFTDFLLSLVQSRYKKRSS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggaggaagagttctctcattgcgacaactacgacgaagaggaggaacccaaa
acgatgtcgcaatgttccatcggagctttacaacaacaacaacagcagcaaaagtttgtc
gttgtcggttatgcccttacctctaagaaaatcaagagctttttacaaccaaagttcgaa
ggtttagccaggaataaggggatattatttgttgcaattgatcaaaatagacctctctca
gaccagggtccttttgatattgtattgcacaagttgacaggaaaagaatggcgccagatt
cttgaggattatagacaaacacatccagaagtcacagttctagatcctcctgatgccata
caacatttacacaatcgccaatcgatgctacaatgcgttgcagacatgaatttatctacc
tcctatggaagagttggtgttcccaggcaattagtcattaaaaaggatgcatcttctatt
gctgatgctgtagataaagctgggttgatactaccccttgttgcaaaaccattggttgct
gatggaagtgcaaagtcacatgaattgtcacttgcttatgatcagtactccctccagaaa
ctagaacctccacttgttcttcaggagtttgttaaccatggaggtgttctctttaaggtt
tatattgttggagaagccattaaagtggtcaggcgtttctcattacctgatgtaactaaa
agagaactctctaaagttacgggtgtttttcggtttccacgggtttcctgtgctgcagct
tctgcagatgatgcagatttggaccctagtgtggctgaacttccccctcgccctttactt
gaaagactggccaaagagcttaggtggcgactgggtcttcggctatttaacctagacatt
atccgggagcatggaactagagatcatttttatgtgattgacataaattactttcctggg
tatgggaaaatgccggggtatgaacatatatttacagacttcctcttgagccttgtgcag
agtcgatacaagaaaagatctagctag

DBGET integrated database retrieval system