KEGG   Gossypium raimondii: 105772647Help
Entry
105772647         CDS       T04129                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gra  Gossypium raimondii
Pathway
gra03040  Spliceosome
gra04141  Protein processing in endoplasmic reticulum
gra04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gra00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105772647
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105772647
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105772647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gra01009]
    105772647
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gra03041]
    105772647
   03009 Ribosome biogenesis [BR:gra03009]
    105772647
   03110 Chaperones and folding catalysts [BR:gra03110]
    105772647
   04131 Membrane trafficking [BR:gra04131]
    105772647
   03051 Proteasome [BR:gra03051]
    105772647
   03029 Mitochondrial biogenesis [BR:gra03029]
    105772647
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gra04147]
    105772647
Protein phosphatases and associated proteins [BR:gra01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105772647
Spliceosome [BR:gra03041]
 Complex B
  Other components
   Prp19 complex
    105772647
 Complex C
   Prp19-CDC5 complex
    105772647
Ribosome biogenesis [BR:gra03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105772647
Chaperones and folding catalysts [BR:gra03110]
 Heat shock proteins
  HSP70 / DNAK
   105772647
Membrane trafficking [BR:gra04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105772647
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105772647
Proteasome [BR:gra03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105772647
Mitochondrial biogenesis [BR:gra03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105772647
Exosome [BR:gra04147]
 Exosomal proteins
  Proteins found in most exosomes
   105772647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 105772647
NCBI-ProteinID: XP_012449497
UniProt: A0A0D2VCW1
Position
10
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA
EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVEAKNSLENYAYNMRNTIKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGGGMDEDAPPTGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaaggagaaggaccggcgatcggtatagatctcggcacgacttactcttgc
gttggagtatggcaacatgaccgagttgaaatcatcgccaacgaccaaggcaaccgtacg
acgccgtcctacgttgctttcaccgattccgagcgtttaatcggtgatgccgctaagaac
caagtcgccatgaatccgatcaacaccgtcttcgatgctaagcgattaatcggcagaaga
tatagcgattcgtcggttcaaagcgatatgaagctttggccttttaaggtaatcgccggt
cctggtgataagcccatgattgttgttacttacaagggcgaggaaaaacaatttgctgcc
gaggaaatctcatctatggttttaatcaagatgcgtgaaatcgccgaggcttatctcgga
gcgacgattaagaacgctgtcgttactgtcccagcttatttcaatgactcccaaaggcaa
gctaccaaagatgccggagtcattgctggtcttaacgttatgcgaattatcaacgagcca
acagccgccgccattgcttacggtcttgacaagaaagccaccagtgttggtgaaaagaat
gtgttgattttcgatttgggtggtggtacttttgatgtttcattgcttactattgaagaa
ggtatctttgaagttaaggccactgctggtgatacacatttgggtggtgaggattttgat
aataggatggttaaccatttcgttcaagaatttaagaggaagaataagaaggatattagt
gggaaccccagagcattgaggaggttgaggactgcttgtgagagagcaaagaggactctt
tcatcgactgctcaaactaccatcgagatcgattcattgtacgagggtattgacttttac
accacgataactcgtgcaaggtttgaggagcttaacatggatctttttaggaagtgtatg
gagccagttgagaagtgtttgagggatgctaagatggataagagcagtgtccatgatgtt
gttcttgttggtggttccactcgtattcctaaagtgcagcagttgttgcaagacttcttc
aacgggaaggagctctgcaagagcattaatcctgatgaggccgttgcttatggtgctgcg
gttcaggctgctatcttgagtggtgaaggaaatgagaaggttcaggatctattgcttttg
gatgtcactcctttgtcccttggactcgaaactgctggtggtgttatgactgttttgatt
ccgagaaacactaccattcccaccaagaaggagcaggtgttttcaacttactctgataac
caacccggtgtcttgatccaagtttatgagggtgagagagctcgaacccgggacaataat
ttgttgggtaaattcgagctctctggcattccaccagcacccagaggcgttccccaaatt
acagtttgcttcgacattgatgctaatggcatcttgaatgtctctgccgaggacaagact
actggccagaagaacaagattaccataacaaatgataagggtcggttgtcgaaggaagaa
atcgagaagatggttcaagaagccgagaagtacaagtccgaggatgaggagcacaagaag
aaggttgaagccaagaattcattggagaactatgcctacaacatgaggaatactatcaag
gatgagaagattggttcaaagcttgacccggctgacaagaagaagattgaagatgccatt
gatggagcaatccaatggttggatggcaaccagctagccgaggctgatgaattcgaggat
aagatgaaggagctcgagagcatctgcaatcctatcattgccaagatgtaccaaggtgca
ggggctgacatgggtggtggcatggacgaggatgccccacctaccggtggcagcggtgct
ggacctaagatagaagaagtcgactaa

DBGET integrated database retrieval system