KEGG   Gossypium raimondii: 105773006Help
Entry
105773006         CDS       T04129                                 

Definition
(RefSeq) methionine S-methyltransferase-like
Organism
gra  Gossypium raimondii
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Methyltransf_31 MTS PrmA Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Met_10 Methyltransf_32 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 105773006
NCBI-ProteinID: XP_012450015
UniProt: A0A0D2UEU2
Position
10
AA seq 1081 aa AA seqDB search
MTLEEFLKQCEQSGDGAYAALKSLLEKLEDPKTRTEARVFLSDLQSRVGSSDDCFHKYHF
RIQDIYLDRSEGYQGRKKLTMMVIPSIFMPEDWSFTFYEGLNRHPDSIFKEMTVAELGCG
NGWITIAIAEKWLPAKVYGLDINPRAVKVSCINLYMNAFDEKGQPIYDAEKKTLLDRVEF
HESDLLSYCREHDIKLERIVGCIPQILNPNPEAMSKMITENASEEFLHSLSNYCALQGFL
EDQFGLGLIARAVEEGIAVIKPTGILIFNMGGRPGQGVCRRLFERRGFRVTRLWQTKVLQ
AGDTDISALVEIEKNSPHRFEFFMGLSGDQPICARTAWAYGKTGGRISHGLSVYSCQLRQ
PNQVKVIFEFLRSGFQEISSSLDLSFEDDLVADEKIPFLAYLSSVLKENSCFPYEPPAGC
KRFRNLIAGFMKTYHHIPLTSDKVVVFPSRTVAIENALRLFSPHLAIVDEHLTRNLPREW
LTSLAIETAENGLSDDVVTVIEAPRQSDLMIELIKRLKPQVVVTGIAHFEAVTSSAFVQL
LDATGEIGSRLFLDISDHFELSSLPGTIGVLKYLSGTPLPSHAAIVCGLVKNQVYSDLEV
AFVISEEEAILKALSKTVEILEGNTSLISQYYYGCIFHELLSFQLTDRHPHLERRSEKSK
SVEVIGFATSAISVLSNAELSISDDGYPLVRMDVDQWFLPVPSPVKAAIFESFSRQNMSE
SEIDVTPCIKQFVQTEYGFPTDSGTEFIFSDCSQALFSKLVLCCIQEGGTMCFPAGSNGN
YVSVAKFLKANTVHIPTNSERGFKLTEDILIKVLETMKKPWVYISGPTINPTGLLYSNQE
MENILSACARFGARVVIDTSFSGLEFEYEGWGGWNLGSCLSKISSSGNPSFCVSLLGGLS
LKLLSGALKFAFLALNEPILIEAFHSFPGLSKPHCTDKYTIKKLLSLREQKGGLLDVAME
QIRILENRAKCLKEVLENCGWDVLRPCAGVSMVAKPSFLGKAVKVNHSLKHTGSGEQDAT
YEIKLTDASLREAVAKTTGLCINSGSWTGIPGYCRFTIALEESEFEQALACLVKFKSIVD
N
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaggaatttttgaagcagtgcgagcagtcaggtgatggtgcttacgctgcc
ctcaaatcgcttctggagaagcttgaggatcccaagacccgcactgaagcccgggtcttc
ctttcggatcttcaatcccgggtcggttcctccgatgattgcttccacaaataccatttc
cggatacaggacatttacttggatcggtctgaaggctatcagggaaggaagaaactgaca
atgatggtgatccctagcatttttatgccagaagactggtcgtttaccttttatgaagga
ctcaatagacacccagattccattttcaaggaaatgacagttgctgagcttggctgtgga
aatggatggataactatagccattgctgagaaatggttgcctgctaaggtttatggcctc
gatataaatccaagagcagtgaaggtttcttgcataaacttatacatgaatgcttttgat
gagaaaggccaaccgatatatgatgcagaaaagaaaactttactggatagggtggagttt
catgaatctgatctgctatcttattgtagggaacatgatattaaacttgaacgaattgtt
ggatgcatacctcagattcttaatccaaatccagaggccatgtccaaaatgatcacggaa
aatgcaagcgaggaatttctacactctttgagtaattattgtgcacttcagggttttctt
gaggatcaatttggcttaggtctgattgccagggcagttgaggaaggaattgctgtcatt
aaacctacaggtattttgatcttcaatatgggaggccgtcctggacaaggagtttgtaga
cgcctgtttgaaagacggggtttccgtgtcaccaggctttggcaaaccaaagttcttcag
gctggggacactgatatttcagccttggttgaaattgagaagaatagtccacaccgtttt
gagttctttatggggctttctggagatcaacctatttgtgctcgcacagcatgggcctat
ggaaagactggtggccgtatctctcatggattatcggtttacagctgtcaacttcgtcaa
ccaaaccaggtcaaggtaatatttgaatttcttagaagtggcttccaagagatcagtagc
tctttagatttatcttttgaagatgatttagttgcggatgagaagattccattcctagcc
tatctttccagtgttttgaaagagaattcctgcttcccatatgagccaccagctggatgc
aaaagatttcgtaatctaattgctggctttatgaaaacttaccaccatattccacttact
tctgataaagttgttgtctttccttcaaggactgtggcaattgagaatgcccttcggctg
ttttccccccatcttgcaattgttgatgagcatttgactcggaacttacccagggaatgg
ttaacatctttggcaattgagactgcagaaaatggactgtcagatgatgtagttactgtc
attgaagcaccacgccagtcagatttaatgatagagcttataaaaaggctgaagccacag
gttgtggtcactgggatagctcattttgaggctgttactagttcagcctttgtgcaacta
ttagatgccaccggagaaattgggtctcgccttttcttagacatatctgatcacttcgaa
ttatccagccttccaggtaccattggggtactaaaatatctatcaggaactcctttgcca
tcacatgcagcaatcgtttgtggcctggtaaagaatcaggtttattcagatttagaagtt
gccttcgtaatttcagaagaagaggccatcttgaaggccttgtcaaaaactgttgaaata
cttgaagggaatacctcattgattagccagtactattatggttgtatttttcatgagctt
ctatcttttcaacttacagacagacatccacatctagagaggagatctgaaaagtccaaa
tcagttgaggtgattgggtttgctacttctgcaatctctgtccttagtaatgctgaatta
tccatttctgatgatgggtacccccttgtacgtatggatgtggatcagtggttccttccg
gttccttctccggttaaggctgctatctttgaaagtttttcccggcaaaatatgtctgag
tctgaaattgatgttactccttgtataaagcagtttgttcagaccgaatatgggttccca
actgatagtggcacagaatttatattttcagactgctcacaagctcttttcagtaaactg
gtcctttgctgcatccaagaagggggaactatgtgctttcctgctggctcaaatggaaat
tatgtttctgttgccaaatttttgaaagcgaacactgtacatatccccacaaactctgag
cgaggctttaagctgacagaggatatactcattaaagtgcttgagactatgaaaaagcca
tgggtatatatttctggtccaacaatcaacccaactggcttgctttacagcaaccaagag
atggaaaacattttaagtgcatgtgcaagatttggggcaagagtggtgattgatacttca
ttctcaggactggaattcgaatatgaaggttggggtggctggaatctggggagctgtttg
tcaaaaatatcttcctctggcaacccctctttttgtgtttctctgcttggagggctgtct
ctgaaactgcttagtggagcactcaaatttgcctttctggctctaaatgaaccaattcta
attgaagcatttcatagctttcctggcttaagcaaacctcattgtacagataaatataca
atcaagaagttgttgtctctgagagagcagaaaggaggtttgttggatgttgctatggaa
caaataagaattttggaaaacagagcgaagtgtttaaaagaggtccttgaaaactgtggc
tgggatgtgcttagaccctgtgctggtgtttccatggtggcaaagccctctttcctcgga
aaggctgtaaaggtcaaccattcacttaaacatacaggcagtggtgaacaagatgccacc
tatgaaattaagctaactgatgcatccttgagggaagccgttgccaagacaacgggcttg
tgcatcaacagtggatcatggactggaattccaggctattgtcgcttcaccattgccttg
gaagagagtgaatttgagcaagcattggcttgcctagtcaaatttaaaagcatagtcgat
aactga

DBGET integrated database retrieval system