KEGG   Gossypium raimondii: 105775561Help
Entry
105775561         CDS       T04129                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 2-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
gra  Gossypium raimondii
Pathway
gra00350  Tyrosine metabolism
gra00360  Phenylalanine metabolism
gra00380  Tryptophan metabolism
gra00950  Isoquinoline alkaloid biosynthesis
gra00965  Betalain biosynthesis
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105775561
   00360 Phenylalanine metabolism
    105775561
   00380 Tryptophan metabolism
    105775561
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    105775561
   00950 Isoquinoline alkaloid biosynthesis
    105775561
   00965 Betalain biosynthesis
    105775561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gra04147]
    105775561
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     105775561
    4.1.1.105  L-tryptophan decarboxylase
     105775561
Exosome [BR:gra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105775561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105775561
NCBI-ProteinID: XP_012453526
Position
11
AA seq 487 aa AA seqDB search
MGSLYPHYEEENYSSNTANLLNPEEFRRQGHMIIDFIADYYQNMEKYPVLSQVQPGYLAK
LLPKSAPNIPEPIETILLDIQQYIIPGITHWQSPNYFAYFPSSGSIAGFLGEVLSTGFNV
VGFNWISSPAATELEFVTMDWLGQMLGLPQSFLFSGTGGGVIQGTTCEAILCTLVAARDQ
MLAKVGRENMGKLVFYGSDQTHCALLKAAKVAGLECKNFRAIKTMRSTAFQLSAESLRTT
IRLDVEVGLIPAFLCATIGTTSTTAVDPIRSLSEVTKEYGMWIHVDAAYAGSACICPEYR
HFIDGVENVNSFSFNAHKWFFTTLDCCCLWVKDPGALTKSLSSSAEYLKNNASDSKQVVD
YKDWQITLSRRFRSMKLWLVLRSYGVENLRNFLRSHVKMAKRFQQLVESDNRFEVVVPRN
FAMVCFRVLPTTLKKEPNGCKVFMTHSIVEGIYVIRFAVGATLTEDKHVIKAWKVVQETV
DGMLATI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttgtatccccactatgaagaagaaaactactcttccaacactgctaacctt
ctaaatccagaagaatttaggagacaaggtcatatgatcatagatttcatagctgattat
taccaaaacatggaaaaataccccgttctaagccaagtccaacctggttaccttgccaaa
cttctaccaaagtccgcccctaatattccagagcctattgaaacaatcctcctcgatatc
caacaatacatcattcccggcataactcactggcaaagccccaactactttgcgtacttc
ccttcaagtggcagcattgctggctttcttggagaggtgcttagcaccggcttcaatgtg
gtggggttcaattggatatcatcaccagccgcgactgagcttgaattcgtaaccatggat
tggcttggccagatgcttgggcttcctcaaagtttccttttctctggaactggcggtggt
gttatacaagggactacatgtgaggccattttatgcacactagtagccgccagagatcaa
atgttagccaaagtggggagagagaacatggggaagttagttttttatgggtcagaccaa
acccactgtgcacttttaaaggcagctaaagtcgctggtttagagtgtaagaactttagg
gcgattaagacaatgagatccacagcatttcaactatccgcagaatcattgcgaacaaca
ataagattggacgttgaagttggacttatcccagcttttctttgtgccaccatcgggaca
acatcaacgactgccgttgatccaatacggtcgttaagtgaagtaaccaaagagtatgga
atgtggatccacgttgatgctgcttatgcaggaagtgcctgtatatgccctgagtatcgt
catttcattgatggggtagagaatgtaaactcatttagtttcaatgcccataaatggttc
ttcactactttggattgttgttgtctttgggttaaagatcctggtgcactaacaaagtca
ctctcatcaagtgctgagtacctcaaaaataatgcaagtgattccaaacaagttgtggat
tacaaagactggcaaataacccttagcagaaggtttcgctccatgaagttatggcttgtt
ttgagaagctatggtgtggagaatcttaggaacttcctaaggagccatgtaaaaatggca
aaacgtttccaacaactggttgaaagtgacaataggtttgaagtggtggtgccaaggaac
tttgctatggtatgtttcagggttttgccaacaacacttaaaaaggagccgaatgggtgc
aaagtttttatgactcactctatagttgagggtatttatgtgatacggtttgctgttggt
gccactctgacagaggataaacatgttatcaaggcttggaaagtggtgcaagagacggtt
gatggcatgttggctactatataa

DBGET integrated database retrieval system