KEGG   Gossypium raimondii: 105779222Help
Entry
105779222         CDS       T04129                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 6-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
gra  Gossypium raimondii
Pathway
gra00520  Amino sugar and nucleotide sugar metabolism
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    105779222
Enzymes [BR:gra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     105779222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-GeneID: 105779222
NCBI-ProteinID: XP_012458452
UniProt: A0A0D2RZ83
Position
12
AA seq 313 aa AA seqDB search
MRILVTGGAGFIGSHLVDKLMEKEKSEVIVADNYFTGSKDNLKKWIGHPRFELIRHDISR
PLFVEVDQIYHLACPASPIFYKYNSVKTIKTNVMGTLNMLGLAKRLRARILFTSTSEVYG
DPLEHPQKETYWGNVNPIGVRSCYDEGKRMAETLMFDYHRQYGIEIRIARIFNTYGPRMN
IDDGRVVSNFIAQAIRNEPLTVQLPGTQTRSFCYVSDLVDGLTQLMEGTDTGPINLGNPG
EFTMNELAKAVQELINPEVQISEVENTPDDPRQRKPDITKAKEVLGWEPKVNLHEGIPLM
EDDFRQRLGVPRT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctggttactggaggtgccggattcatcggctcccacctagtcgacaagttg
atggagaaggaaaagagtgaggttattgttgctgataactactttactggctccaaggac
aatctgaagaaatggatcggacacccaagattcgaacttattcgtcacgatattagccgg
ccgttgtttgttgaggtcgatcagatataccacctagcttgccccgcttctccaatcttc
tacaaatacaattctgtgaagacgataaagacgaatgtgatgggtacattgaatatgttg
ggacttgcaaaacgcctcagagcaaggattttatttacctcaacttcagaggtttacgga
gatccacttgagcatccccaaaaggagacctactgggggaatgttaaccccattggagtt
cggagctgctacgatgaaggaaagcgaatggcggaaactttaatgtttgattaccacagg
caatatggaatcgagattcggattgctagaatcttcaatacttatggaccgcgcatgaac
atcgatgatgggcgtgttgtcagcaattttatagctcaagcaatccgtaatgagccattg
acagttcaattaccgggaacacagacaaggagcttctgttatgtctcggacttggtagat
ggccttactcaacttatggaaggaacggacaccggacccatcaatcttgggaatccaggt
gaattcacgatgaacgaacttgcaaaagcagtgcaggagcttataaatccggaggtacaa
atatcagaggtggaaaacacaccggatgatccgcgacaaaggaagccggacattacgaaa
gcaaaggaggtgttaggatgggaaccgaaggtgaacttgcacgaaggaattccgcttatg
gaggatgacttccggcagaggctgggtgtccctaggacgtaa

DBGET integrated database retrieval system