KEGG   Gossypium raimondii: 105779472Help
Entry
105779472         CDS       T04129                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
gra  Gossypium raimondii
Pathway
gra00010  Glycolysis / Gluconeogenesis
gra00562  Inositol phosphate metabolism
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105779472
   00562 Inositol phosphate metabolism
    105779472
Enzymes [BR:gra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105779472
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105779472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105779472
NCBI-ProteinID: XP_012458695
UniProt: A0A0D2RZI5
Position
12
AA seq 503 aa AA seqDB search
MLLTRLPDKMTLAAAVLFFLLTLVSNSRADRDFDVRHRLSTVTRYSAVKDIVDYSFQPTD
IPVGCTPIHLNLVARHGTRSPTKKRMRELEKLASHIKELLKDAKEKNLSPQKVPAWLLKW
ESPWKGKLRGGELDTKGEEELYQLGIRVRERFPDLFNEEYHPDVYPIKTTQVPRASASAV
AFGMGLFSGNGSLGLARHRAFAVTSESRASDITLRFFDCCQTYKDFRKSHEPAVDKLKEP
IIAEITCALAKRYEFNFTRQDISSLWFLCKQETTLLDITDQACSLFSPTEVALLEWTDDL
EVFMLKGYGKSLNYRMGVPLLKDVIQSMDQALKAKEDNQAPGSYEKARLRFAHAETVVPF
SCLLGLFLEGSDFQRIQKEEPLDFPPKPPKNRSWRGSIVAPFAGNNMLVLYSCPANSSSK
YFVRALHNEHPIAMPGCGGTDFCPFEVFKESIVSPHLKHDYNTLCQVNLDQPKQKPETSK
LLKLFRWLFSFGNDDIPSDRVEL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaacaaggctgccggacaagatgactttggccgccgccgttttatttttcctt
ttgacgctagtttctaattcaagagctgatcgagatttcgatgttcgtcatcgcctctct
accgtaacaagatattctgcagtgaaagatattgtagactattcctttcagcctactgat
attcctgttggatgtactcctatccacttaaatctcgtggcaagacatggaactcgttct
cctactaagaagcggatgagagagttggaaaagttggcttctcatataaaggaacttcta
aaagatgccaaagaaaagaatttgtccccacagaaagttcctgcttggttactgaaatgg
gaatccccttggaaagggaaattgaggggtggagaattagatacaaaaggagaagaggaa
ttatatcaacttggaatcagggttagggaaagatttcctgatttatttaatgaggaatac
caccctgatgtgtatccaataaagactacgcaagttcctcgggcttctgccagtgctgtt
gcatttggcatggggctatttagtggcaatggaagtctaggactggcgcgtcatcgagct
tttgctgttacaagtgaaagtcgtgcaagtgacataaccctgaggttttttgattgttgt
caaacctataaggactttaggaaaagccatgagcctgctgttgataaactgaaagaaccc
atcattgctgaaattacctgtgcattggcaaagcgatatgagttcaatttcacaagacag
gatatatcttctctctggtttctttgtaaacaggaaacaaccttgttggatataactgat
caagcttgtagtcttttcagtcccactgaggtggctttgctggagtggacagatgattta
gaggtgttcatgttaaagggctatggtaaatccttaaattatcgaatgggagtgcctctg
cttaaagatgtcattcaatccatggaccaagcactcaaggctaaagaagataatcaagct
cctggcagttacgagaaggcaagattgcgttttgcacatgcagaaacagtggttcctttt
tcatgcttgcttgggcttttccttgaaggatctgatttccaacgaatacaaaaggaggag
cctttggatttccctcctaaacctcccaagaacagaagttggagaggcagcattgtggcc
ccttttgctggaaataatatgctggtcttatacagttgcccagctaattcttcaagcaaa
tacttcgtgcgagctctacacaacgagcatcccattgcaatgcctggttgtggcggtact
gatttctgtccatttgaagttttcaaggagagcattgtaagtccgcacttgaagcatgat
tacaataccctttgccaagtgaatcttgatcaaccaaagcagaagcctgaaaccagtaag
ttattgaaactgttccgttggctcttttcgttcgggaatgatgatataccatccgataga
gttgaattgtag

DBGET integrated database retrieval system