KEGG   Gossypium raimondii: 105779991Help
Entry
105779991         CDS       T04129                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
gra  Gossypium raimondii
Brite
KEGG Orthology (KO) [BR:gra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105779991
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     105779991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 DAO EF-hand_7 NAD_binding_8 Pyr_redox_3 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 105779991
NCBI-ProteinID: XP_012459495
UniProt: A0A0D2V4U0
Position
12
AA seq 582 aa AA seqDB search
MTILSFFTRASRAFNGYPASAKLLLLCTLSLSGGGVVAYSEAQVDASKTSVQVNEKDCKK
KRVVVLGTGWAGISFLKDLDVSAYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRN
IIKKRNGEIQFWEAECMKIDAANKKLLCRYTVENNLVGNDEFSLEYDYLVLAVGAQVNTF
NTPGVLENCHFLKEVEDAQKIRRTVIDCFEKAVLPGLSEEERRINLHFVIVGGGPTGVEF
AAELHDFVQEDLVNLYPSVKDMVKITVIQSGDHILNMFDERISSFAEQKFRRDGIEVQTG
SRVISVSDKEITMKLKAKGEICSVPHGLVVWSTGVETRPFVKDFMGQIGQANRRVLATDE
WLRVKGCEDVYALGDCATINQRKVMEDIAAIFKAADKDNSGFLTVEEFKDVIDDILERYP
QVEHYLKSKHLRDVTDLMKDSEGNDIDEVDIEGFKLALCQADSQVKNLPATAQVAAQQGA
YLSKCFNRKSKWKDNPEGPRRFRGSGRHQFHPFQYKHLGQFAPLGGEQAAAELPGDWVSV
GRSTQWLWYSVYASKQVSWRTRVLVVSDWTRRFIFGRDSSRI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcctgtctttcttcaccagagcttcacgggctttcaatggctaccctgcttct
gccaagcttttgcttctctgtactctcagtctcagtggtggaggtgttgtggcttactca
gaagcacaagtagatgctagcaaaactagtgttcaagtgaacgaaaaagattgcaagaaa
aagagagtggtggttcttggaacgggatgggccggtattagtttccttaaagatcttgat
gtttcggcttacgatgttcaggttgtttcaccccggaattattttgcattcaccccattg
ttgcctagtgtcacctgtggaacggttgaagcacggagcattgtagagcctgttcgaaac
attataaagaagagaaatggagaaatacagttttgggaagctgaatgtatgaagattgat
gctgcaaacaagaaacttttgtgccggtatactgtggaaaataacttggtgggaaatgat
gaattctctttggaatatgactatttggttctagcagtgggagcacaagtaaatacattt
aacacccctggtgtccttgagaactgccactttctgaaggaagtcgaggatgcacagaag
atacggaggaccgttattgactgctttgaaaaggctgtccttcctggactaagtgaagaa
gaacgaaggataaaccttcattttgtaattgttggagggggacctactggcgtggagttt
gcagcagagttgcatgactttgttcaggaggatttggtcaacttatatccttcggttaaa
gatatggtgaaaataactgtgattcaatcaggggaccatattctgaatatgtttgatgaa
cgaataagtagtttcgctgagcaaaaatttcgaagagatggtatcgaagttcaaactgga
tctcgtgttattagtgtttccgataaggaaatcactatgaagctcaaggcgaaaggagag
atttgttctgtacctcatggattggttgtttggtccactggtgttgagactcgccctttt
gtgaaggacttcatggggcaaattgggcaggctaacagacgtgttctagcaaccgatgaa
tggttgcgagtaaaaggatgtgaagatgtgtatgcccttggtgattgcgccactataaat
cagcgtaaagtcatggaagatatcgctgccatatttaaggctgcagataaagataactct
ggtttcttaaccgttgaggaattcaaagatgttatagacgatatccttgagaggtatccg
caagtggaacactatttgaagagcaagcacctgagggatgtaactgatctgatgaaagat
tccgaggggaatgatatagatgaagtggacattgaaggatttaagctagccctttgtcaa
gctgattcacaagtgaagaatctgcctgcaacagctcaggttgcggcacaacaaggtgca
tatctttctaaatgcttcaaccgcaagtctaagtggaaagataatcctgaaggcccacgg
cgttttagagggtctggtcgtcatcaattccatccatttcaatacaaacaccttgggcaa
tttgctcctttaggaggggagcaagcagctgctgagctgcctggggactgggtttccgtg
ggtcgtagcacacagtggctctggtactctgtatatgcaagcaaacaagtgagctggcgt
actcgggtgttggtggtatccgattggactcgaagattcattttcggaagagattcaagc
cgcatttga

DBGET integrated database retrieval system