KEGG   Gossypium raimondii: 105780980Help
Entry
105780980         CDS       T04129                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
gra  Gossypium raimondii
Pathway
gra00601  Glycosphingolipid biosynthesis - lacto and neolacto series
gra00603  Glycosphingolipid biosynthesis - globo and isoglobo series
gra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    105780980
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    105780980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gra01003]
    105780980
Enzymes [BR:gra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     105780980
Glycosyltransferases [BR:gra01003]
 Glycan extension
  P blood group
   105780980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB Caps_synth
Motif
Other DBs
NCBI-GeneID: 105780980
NCBI-ProteinID: XP_012460987
UniProt: A0A0D2VY51
Position
12
AA seq 424 aa AA seqDB search
MTTTKIFVSPVVIPAKSPVAFMILFALLMFLMLTDSIVSNISLESAAFTQKQDSQSLQTL
TVTRNIKSDVVLPLSLTVSTKNNIVDGDSEHQNSLASSLGVREKRGIGKFRRKLPEHEIL
KSDELTKKFHGRVLEFFNRGCELHFFMTWISKVGSFGRREIMAAESVFKAHPNGCLMILS
RTMDSVQGYRILKPLLDRGFKVIAVAPDFPFLVKNTPAEAWLDDMKSGKKDPGVIPLAQN
LSNLMRLVVLYKYGGVYLDTDFIVMRSFKGLKNTIGAQSIDVVSKNWTRLNNAVLVFDMK
HPLVLKFIEEFALTFDGNKWGHNGPYMVSRVVRRVEGRPGYNFTILPPMALYPVDWIKIG
GLFKMPKDRAGSRWIESKVQQLKRQTYGVHLWNKQSSKLVVEEGSVMERLMAQNCVLCTH
IYSS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaccaaaattttcgtcagcccggttgttattccagctaaatcccctgttgct
tttatgatcttgtttgctcttctgatgtttcttatgttaacagatagtatcgtttctaat
atttcgctggaatcggctgccttcactcaaaaacaagattcccaatcgttgcagactcta
acagttacaagaaatatcaagtcggatgttgttcttcctctgtcactgactgtttccacg
aaaaacaacatcgttgatggtgatagtgaacatcagaattctctagcttcttccttgggt
gttagagaaaaacgtggaattgggaaattcaggagaaaactgccagaacatgagattttg
aagtcagacgagttgacaaagaagttccatggccgagttcttgaattcttcaaccgtggg
tgcgagcttcacttcttcatgacatggatttcaaaggtagggtcctttgggagaagagaa
atcatggctgctgaaagcgttttcaaagcccaccctaatggttgcttgatgattctatcg
agaaccatggactcagtacaaggttacaggatccttaaaccgttgcttgatcgtgggttc
aaagttatagcagtggcaccggactttccatttctggtcaagaatacacctgctgaagct
tggcttgatgatatgaagagtgggaaaaaggaccctggtgtgattccgttggctcagaat
ctatctaatttgatgaggcttgtagtgttatacaagtacggaggtgtttacttggatacg
gatttcatagtgatgaggagttttaaagggttgaagaacacaattggagcacaaagcatt
gatgtggtgtctaagaactggacaagattgaacaatgcagtactggtctttgatatgaaa
catccacttgtactcaagttcattgaggaatttgctttgacttttgatgggaacaaatgg
ggacataatgggccttatatggtttcaagggtagttcgcagagtagaaggcagacctggt
tataattttacaatcttgccacctatggctttgtatcctgttgattggattaaaatagga
ggtctgtttaagatgcctaaagacagggcaggctcgagatggatagagtctaaggtgcag
cagctaaagaggcaaacatatggagtacatctctggaataagcaaagtagcaaattagtg
gttgaagagggaagtgtaatggaaagattaatggcacagaactgtgttttgtgtacacat
atatatagctcttag

DBGET integrated database retrieval system