KEGG   Gossypium raimondii: 105783744Help
Entry
105783744         CDS       T04129                                 

Definition
(RefSeq) probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
gra  Gossypium raimondii
Pathway
gra00020  Citrate cycle (TCA cycle)
gra00640  Propanoate metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
gra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105783744
   00640 Propanoate metabolism
    105783744
Enzymes [BR:gra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     105783744
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     105783744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 105783744
NCBI-ProteinID: XP_012464824
UniProt: A0A0D2VAB0
Position
13
AA seq 335 aa AA seqDB search
MARQASRLLRSLSSQFSHHKSLLSPQHSRSFSAAPAPQPAVFVDKNTRVICQGITGKNGT
FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAPAI
MEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKPGECKIGIMPGY
IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQT
EGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ
DKIKTLREAGVTVVESPAKIGVAMHDVFKQRGLLN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctagacaagcctcacgactcctccgatctttgtcatcccagttttctcatcacaaa
tccctactcagtccccaacattcacggtcgttctcggcggctccggcgcctcaaccggcg
gttttcgtagacaagaacacacgcgttatttgccaaggcataaccggaaagaatggtact
ttccacaccgagcaagccatcgaatatggcactaagatggttggtggagttacaccgaag
aagggtggcacagagcacttaggacttcctgttttcaactcagtagctgaagcaaaagct
gaaaccaaggccaatgcttctgtcatatatgttcctcccccttttgctgcgccggctatc
atggaggccatggaagctgagctggaccttgttgtttgtatcacagaaggaattcctcaa
catgacatggtccgtgtgaaggctgcccttaatcagcaatcaaaaaccaggctgattggt
ccaaactgccctggcatcattaaacctggggaatgcaagattggaattatgcctggatat
attcacaaaccaggtcgcataggaatcgtttctcgatccggcactttaacatatgaagca
gtttttcaaacaactgcagttggtctggggcaatcaacctgcgtaggaattggtggggat
ccgtttaatgggaccaactttgttgattgtgtgaccaagttccttgctgatcctcagaca
gaaggtatcattctaattggtgagataggaggcacagcagaagaagatgctgctgcacta
ataaaggaaagtgggactgaaaagcccattgttgccttcattgctggacttactgctcct
ccaggacggcgtatgggtcatgcaggagctatagtatcagggggcaagggtactgcacag
gacaaaatcaagactctaagggaagctggagtgacagttgttgaatcacctgcaaagatt
ggtgtagcaatgcatgatgttttcaagcaaagaggtctcctgaattag

DBGET integrated database retrieval system